BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00782 (734 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.15c |cdc3||profilin|Schizosaccharomyces pombe|chr 1|||Ma... 63 5e-11 SPBC418.01c |his4|SPBC887.20c|imidazoleglycerol-phosphate syntha... 28 1.2 SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomy... 28 1.6 SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni... 26 6.4 SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc... 25 8.5 >SPAC4A8.15c |cdc3||profilin|Schizosaccharomyces pombe|chr 1|||Manual Length = 127 Score = 62.9 bits (146), Expect = 5e-11 Identities = 31/89 (34%), Positives = 47/89 (52%), Gaps = 1/89 (1%) Frame = +2 Query: 56 MSWQDYVDKQLMASRCVTKAAIAGHDGN-VWAKSEGFEISKDEVAKIVAGFENESLLTSG 232 MSWQ YVD L+ + + +AAI G+ VWA S GF +S E+ + AGF++ + Sbjct: 1 MSWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGT 60 Query: 233 GVTIAGTRYIYLSGTDHIIRANLARSACI 319 G+ +AG +YI + I L + I Sbjct: 61 GIILAGQKYITIRAEGRSIYGKLQKEGII 89 Score = 41.1 bits (92), Expect = 2e-04 Identities = 17/46 (36%), Positives = 28/46 (60%) Frame = +1 Query: 295 ELGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLGEYLITCGY 432 +L K G+ C+ T+ +++S Y E P +AA + E L +YL+ GY Sbjct: 82 KLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY 127 >SPBC418.01c |his4|SPBC887.20c|imidazoleglycerol-phosphate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 541 Score = 28.3 bits (60), Expect = 1.2 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 283 YHPRELGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLG 408 +HP + G G+ C+K A + YE+PI + + + G Sbjct: 188 FHPEKSGSAGLRCLK---AFLTGNYEQPISGEASKLIENSFG 226 >SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 523 Score = 27.9 bits (59), Expect = 1.6 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +1 Query: 589 SLVCTCDYFVD--SGPFLYAHR---LLKXXXXXXXXKFVLKFCF 705 +++C C+YF+D +GPFL +++ +L + VLKF + Sbjct: 322 AIMCRCEYFLDMLAGPFLESNQELPVLSLPFSSSVVEIVLKFLY 365 >SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a Pol2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 2199 Score = 25.8 bits (54), Expect = 6.4 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +1 Query: 238 DDSGHALHLPQWHRPYHPRELGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEK 402 D H L + ++ PYH R L + + + Q +S +E +Q AS +E+ Sbjct: 216 DPLNHVLDIREYDVPYHSRTLIDLNI---RVGQWYTVSYHEGHVQISLLASRIER 267 >SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 997 Score = 25.4 bits (53), Expect = 8.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 138 MCGQSRKASKFQKMKWRR 191 MC S++ FQK KW R Sbjct: 19 MCNYSKRLDTFQKKKWPR 36 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,068,082 Number of Sequences: 5004 Number of extensions: 62967 Number of successful extensions: 150 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 149 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -