BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00782 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 27 0.79 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.4 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 26.6 bits (56), Expect = 0.79 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +2 Query: 146 AKSEGFEISKDEVAKIVAGFENESLLTSGGVTIAGTRYIYLSGTDHIIRANLARSACI 319 A + F + KD + A F E +GG T RY + T+ AN A++ + Sbjct: 180 AAAAEFPLQKDVIRVTNAVFVQEGFPLNGGFTYYSNRYYSSNATNVPFAANPAKAVAL 237 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -3 Query: 195 TIFATSSFEISKPSDF-AHTL 136 T+ ++SFE+ KP DF H+L Sbjct: 845 TLTESTSFELKKPKDFRKHSL 865 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 780,386 Number of Sequences: 2352 Number of extensions: 15032 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -