BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00782 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 142 4e-36 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 23 3.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 23 3.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 5.2 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 5.2 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 142 bits (343), Expect = 4e-36 Identities = 63/84 (75%), Positives = 74/84 (88%) Frame = +2 Query: 56 MSWQDYVDKQLMASRCVTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFENESLLTSGG 235 MS QDYVDKQL+ASRCVTKAAIAGHDGN+WAKSEGFE+SK+E+ K+V GFE + +LTS G Sbjct: 1 MSCQDYVDKQLLASRCVTKAAIAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDILTSSG 60 Query: 236 VTIAGTRYIYLSGTDHIIRANLAR 307 VT+AG RYIYLSGTD +IRA L + Sbjct: 61 VTLAGNRYIYLSGTDRVIRAKLGK 84 Score = 90.6 bits (215), Expect = 1e-20 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = +1 Query: 295 ELGKVGVHCMKTQQAVVISLYEEPIQPQQAASVVEKLGEYLITCGY 432 +LGKVGVHCMKT QAVV+SLYE+PIQPQQAASVVEKLG+YL++CGY Sbjct: 81 KLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDYLVSCGY 126 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 22.6 bits (46), Expect = 3.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 170 SKDEVAKIVAGFENESLLTSGGVTIAGTRYIYLSGTDHIIRANLA 304 +K E+ IV GF + L S + G IYL+ +I+ N++ Sbjct: 16 TKSEINDIV-GFLKKGPLDSNVEVVVGVPSIYLTYAKNILPNNIS 59 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 372 LDGFFIERNDHSLLCLH 322 + G IER DH++LC++ Sbjct: 327 ISGAPIERPDHAVLCVY 343 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = -1 Query: 155 PTL-PTHCHHDRQWQLL*HI 99 PT+ P H HH Q Q L H+ Sbjct: 345 PTMGPPHHHHHHQTQSLQHL 364 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 Query: 68 DYVDKQLMASRCVTKAAIAGHDGN 139 D + L RC K G DGN Sbjct: 447 DVISGNLEKGRCTGKIVTVGSDGN 470 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,116 Number of Sequences: 438 Number of extensions: 4432 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -