BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00781 (716 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 23 1.9 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 23 1.9 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 345 ASFLACFFASR-SEEIAIAVTCFERSLANSRVGQLHH 238 A +A F A + I +A+TC+E SL + +L H Sbjct: 290 AQAIAFFSAGNDTTSITLALTCYELSLNKTIQDRLRH 326 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 108 QIMTIIEHKIRNLEKRKSKLTSYRDLQKAGKELNSDQKVAVA 233 QI ++ K+R + K+ +Y+ + KELN D K + A Sbjct: 110 QIEALVPRKLRLADGGKTLEINYKLIDPDLKELNLDTKESYA 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,386 Number of Sequences: 336 Number of extensions: 3115 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -