BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00779 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 26 1.5 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 24 5.9 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 24 5.9 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.8 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.8 bits (54), Expect = 1.5 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Frame = -2 Query: 215 FRTFAHWLCFRTNF--TAGLTKLFTNVIEAMLNEL-FNTKRC*ILNFQKFRLIFVWIF 51 FR F HWLC + F + +F++ + A + L N++R ILN+ F F +F Sbjct: 845 FRIFCHWLCNHSTFGNIILVCIMFSSAMLAAEDPLNANSERNQILNY--FDYFFTSVF 900 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 260 LEIILNGVNPDRTVVF 213 LE ILNG NP T+VF Sbjct: 414 LEEILNGGNPKGTLVF 429 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 23.8 bits (49), Expect = 5.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 521 HADYIKNMITGTAQM 565 HADY++ +I GTA + Sbjct: 197 HADYLQQLIEGTADV 211 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.8 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 189 AKPVCKCTKHNSPVRIDSIKYNLKRHYAEKQIFERTKP 302 A P TK + + +I + + E +IFE TKP Sbjct: 1391 AVPFKLLTKKSRDQALKAINFIEREQQQEMEIFEETKP 1428 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 785,116 Number of Sequences: 2352 Number of extensions: 15843 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -