BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00775 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 71 9e-13 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 60 2e-09 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 56 4e-08 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 52 6e-07 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 47 2e-05 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 45 5e-05 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 42 6e-04 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.006 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.008 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 38 0.010 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.072 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 35 0.072 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 34 0.096 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.13 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) 33 0.17 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.17 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 33 0.22 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 33 0.22 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 31 0.67 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.89 SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 31 1.2 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_10597| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=8.2e-34) 30 1.6 SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 30 2.1 SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 30 2.1 SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) 29 2.7 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 29 3.6 SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) 29 3.6 SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) 29 3.6 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 4.8 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 28 6.3 SB_11898| Best HMM Match : DMP1 (HMM E-Value=1.6) 28 6.3 SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) 28 6.3 SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) 28 8.3 SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 28 8.3 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.3 SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) 28 8.3 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 70.9 bits (166), Expect = 9e-13 Identities = 33/85 (38%), Positives = 54/85 (63%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F +GE++ V DP T RSRGF F+ FK P+++D V+ +G ++ KK+ Sbjct: 128 FEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKMVTTTK---- 183 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 KIF+GGLS+ S+++++ +FS+FG Sbjct: 184 -KIFIGGLSTNTSEEDMKKYFSQFG 207 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 59.7 bits (138), Expect = 2e-09 Identities = 35/85 (41%), Positives = 45/85 (52%), Gaps = 2/85 (2%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEP--KKAKA 426 F YGE+ +++K D TGR RGFAF+ FK D I+ K P K Sbjct: 49 FSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEAD--------AIDPKPAAPIGKPPHL 100 Query: 427 RHGKIFVGGLSSEISDDEIRNFFSE 501 R KIFVGGL E SD++IR +F + Sbjct: 101 RVKKIFVGGLKPETSDEKIREYFGK 125 Score = 53.6 bits (123), Expect = 1e-07 Identities = 22/53 (41%), Positives = 36/53 (67%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 + E+E + + N+R+GFCF++F+SE V+ + +T I G +V+VKRA PK Sbjct: 130 VKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPK 182 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +1 Query: 253 FG-AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 FG AY ++ I T+ ++ R RGF F+ F + +++DK+ H I KVE K+A Sbjct: 123 FGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRA 179 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +2 Query: 143 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 253 G S D N DD KLFVGGLS+ETT + L+++ Sbjct: 12 GTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEY 48 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +1 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 GK+FVGGLS E + + ++ +FS++G Sbjct: 29 GKLFVGGLSYETTKESLKEYFSKYG 53 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/20 (50%), Positives = 18/20 (90%) Frame = +2 Query: 194 RKLFVGGLSWETTDKELRDH 253 +K+FVGGL ET+D+++R++ Sbjct: 103 KKIFVGGLKPETSDEKIREY 122 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 58.8 bits (136), Expect = 4e-09 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 5/90 (5%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVE-----PKK 417 F +GEI+ VK DPNT RSRGF F+ FK E V++ H I + E PK+ Sbjct: 135 FTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST-SHRIQGRLCEVRLPRPKE 193 Query: 418 AKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 K+FVG L ++ + +F++FG Sbjct: 194 ELNVPKKLFVGRLPESTTEKTLMEYFAQFG 223 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 55.6 bits (128), Expect = 4e-08 Identities = 29/94 (30%), Positives = 59/94 (62%), Gaps = 12/94 (12%) Frame = +1 Query: 253 FGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKK---- 417 F +G I + + +K D GRSRGF F+ +++ +S+++V+ +H ++++++EPK+ Sbjct: 70 FSQWGTIVDCVIMKRD---GRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPR 126 Query: 418 -------AKARHGKIFVGGLSSEISDDEIRNFFS 498 A ++ KIFVGGL+S +++I+ +F+ Sbjct: 127 DESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFN 160 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 265 GEIESINVKTD-PNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAK 423 GE+ +++K D N R RGFAF+ F E ++KV A H I K+ E KKA+ Sbjct: 169 GEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAE 222 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/57 (29%), Positives = 32/57 (56%) Frame = +3 Query: 504 WNILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 W + V+ K + +GF F+T+ES VN++LK + +E++ KR+ P+ + Sbjct: 73 WGTI-VDCVIMKRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDE 128 Score = 36.7 bits (81), Expect = 0.018 Identities = 15/54 (27%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQR-KGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 +++V++ D+ +R +GF F+TF+++++V + I K+ +VK+A P+ Sbjct: 171 VIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 224 Score = 33.9 bits (74), Expect = 0.13 Identities = 11/20 (55%), Positives = 18/20 (90%) Frame = +2 Query: 194 RKLFVGGLSWETTDKELRDH 253 RK+F+GGL+W TT++ L+D+ Sbjct: 50 RKIFIGGLNWNTTEEGLKDY 69 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/24 (37%), Positives = 20/24 (83%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 KIF+GGL+ +++ ++++FS++G Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWG 74 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 51.6 bits (118), Expect = 6e-07 Identities = 28/86 (32%), Positives = 46/86 (53%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F +GE+ES+ + G SR + F++FK + K + H IN K V+ K++ Sbjct: 100 FEQFGEVESVRIMRT-FLGYSRNYGFVLFK-DDGPSKEVLKKSHVINGKTVDVGKSR-NF 156 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFGI 510 I+VGGL S ++ +R F +FG+ Sbjct: 157 RVIYVGGLPSHFTEQTVREHFKKFGV 182 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/55 (25%), Positives = 31/55 (56%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKK 417 F YG++ +++ TD TG+S+G + + P +++K++ H I +V ++ Sbjct: 339 FRPYGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPVHVIGKSQVRLRR 393 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 391 NNKKVEPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 N+ PK + +FVGGL+S ++ ++++F +FG Sbjct: 66 NSTLPSPKDIEKNSRSVFVGGLASGTDEEGLKDYFEQFG 104 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/45 (48%), Positives = 27/45 (60%) Frame = +1 Query: 295 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR 429 D T R RGF F+ F++ S DK H INNKKVE KKA+ + Sbjct: 5 DKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +3 Query: 531 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 FDK + +GF F+TFESE + T I K+V+VK+A PK Sbjct: 4 FDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 6/91 (6%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVE-----PK 414 FG G + S + D TG+S G+AF+ + P+ +K V + NK ++ P Sbjct: 47 FGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPS 106 Query: 415 KAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 + ++ +++ GL ++ ++E+ F FG Sbjct: 107 STEIKNANLYISGLPKDMKEEEVEALFKPFG 137 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 46.0 bits (104), Expect = 3e-05 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 15/93 (16%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVF---KAPESI--DKVMAAGEHTINNKKVEPKK 417 F AYGE+ + V D T +SRGF ++ F K ++ DKV G H I+ K+VE K+ Sbjct: 34 FEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKV-ENGAHRIDGKEVEVKR 92 Query: 418 AKARHG----------KIFVGGLSSEISDDEIR 486 A R KIFVGGL + + ++I+ Sbjct: 93 AIPRDDNSATSHEKTKKIFVGGLPEDATKEDIQ 125 Score = 37.1 bits (82), Expect = 0.014 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRT----IGGKEVDVKRATPKPD 674 + +V + D + +GF ++TF +V ++LK I GKEV+VKRA P+ D Sbjct: 40 LTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD 98 Score = 34.3 bits (75), Expect = 0.096 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +2 Query: 161 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHLE 259 N E D KLFVGGL+ ETT++ LR++ E Sbjct: 3 NRQENTNNDPRAKLFVGGLNRETTNETLREYFE 35 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 D+TK+ +GF F+ +E ++L K + GK V+ K+ATP+ Sbjct: 147 DETKH--RGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGL+ E +++ +R +F +G Sbjct: 15 KLFVGGLNRETTNETLREYFEAYG 38 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 10/75 (13%) Frame = +2 Query: 86 FAQDITTDNQLNGNAENGGG--DSQDHNSAEAPGRDDD--------RKLFVGGLSWETTD 235 FA T N L ENG D ++ A RDD+ +K+FVGGL + T Sbjct: 62 FADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHEKTKKIFVGGLPEDATK 121 Query: 236 KELRDHLEHTVK*RV 280 +++++ +E ++ +V Sbjct: 122 EDIQEAIESLLEEKV 136 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 310 RSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR 429 + RGFAF+ + D++ + + K VE KKA R Sbjct: 150 KHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/60 (36%), Positives = 36/60 (60%) Frame = +3 Query: 513 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 692 LE++M D+ N+ KG+CF+ F +E +V+ L + GK+V++K+A G GG G Sbjct: 133 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKAADL--GAGGRG 190 Score = 44.4 bits (100), Expect = 9e-05 Identities = 28/89 (31%), Positives = 50/89 (56%), Gaps = 12/89 (13%) Frame = +1 Query: 256 GAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAAGE-HTINNKKVEPKKAKAR 429 G+ ++ S+++ P G+SR F F+ F + ID ++ E H+I+NK+VE K+A R Sbjct: 34 GSEADVSSVSLAKTPE-GKSRKFCFVEFSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPR 92 Query: 430 HG----------KIFVGGLSSEISDDEIR 486 K+F+GGL E S+++++ Sbjct: 93 DDPNELAHVRTKKLFIGGLKDEHSEEDVK 121 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 280 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 I + D T + +G+ F+ F +DK+ + K VE KKA Sbjct: 135 IKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 Score = 28.3 bits (60), Expect = 6.3 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEF 504 K+FVGGL+ + +++ +R +F F Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSF 31 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/68 (29%), Positives = 39/68 (57%) Frame = +1 Query: 304 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARHGKIFVGGLSSEISDDEI 483 +G+S+GFAF+ + E+++ V+ +H I+N V +K + + K+ + + S I + +I Sbjct: 79 SGKSKGFAFVRLRKKEAVESVLGRDDHVIDNSDVSMEK-QDTYRKVILKNIPSSIGESQI 137 Query: 484 RNFFSEFG 507 FS G Sbjct: 138 LEHFSSSG 145 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEV 644 I V +P + +RKG C +TF S +++K K I G ++ Sbjct: 147 IASVYIPENLKTKERKGHCIVTFASVTEAFEVVKKRKHHIHGYDI 191 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 45.2 bits (102), Expect = 5e-05 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 21/86 (24%) Frame = +1 Query: 316 RGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA---------------------KARH 432 +GF F+ F+ P +I+ V+A H ++ K ++PK A A Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSAND 201 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFGI 510 GK+F+GGL+ ++++++ +FS +G+ Sbjct: 202 GKVFIGGLAFGTTEEDLKEYFSTYGM 227 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 531 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 683 F++ KGF F+TF + +L + GK +D K A P+ GPG Sbjct: 134 FERRARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR--GPG 182 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/25 (40%), Positives = 21/25 (84%) Frame = +2 Query: 179 GRDDDRKLFVGGLSWETTDKELRDH 253 G +D K+F+GGL++ TT+++L+++ Sbjct: 197 GSANDGKVFIGGLAFGTTEEDLKEY 221 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 41.9 bits (94), Expect = 5e-04 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 5/84 (5%) Frame = +1 Query: 265 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKK----AKAR- 429 GEI ++ DP TG ++GFAF F S + + T+N+K + P + K+R Sbjct: 177 GEIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAIT----TLNDKDIRPGRRLAICKSRS 232 Query: 430 HGKIFVGGLSSEISDDEIRNFFSE 501 + ++FV G+ S +EI FS+ Sbjct: 233 NSRLFVKGIPKRKSKEEIFQEFSK 256 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 41.5 bits (93), Expect = 6e-04 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 2/56 (3%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--EPK 414 FG YG IE +++ TG+S+GF ++ ++ ES + + AG H I+ K V EPK Sbjct: 83 FGPYGAIEDLSI-IRTQTGKSKGFGYVTYENAESAQRAL-AGTHIIDGKWVIAEPK 136 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +1 Query: 274 ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKAR 429 E++N+ TD TGR RGF F+ F + E ++K + + ++ + ++ +AK R Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEAKPR 175 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 534 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 686 D+ + +GF F+TF S E++ + + + + G+ + V A P+ D GG Sbjct: 130 DRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEAKPRGDSGGG 181 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = +1 Query: 265 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARHGK 438 G+I S+ V TDP G+S+GF F+ F+ PE ++ + + +N K++ ++ A K Sbjct: 133 GKIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV----NVLNGKEIGGRRLWAGRAK 185 Score = 34.7 bits (76), Expect = 0.072 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 F YG I S V D + G S+GF F+ F +PE K + Sbjct: 232 FSPYGTISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAV 269 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 37.5 bits (83), Expect = 0.010 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 F YG ++++++ TD SRGFA++ + PE +K + Sbjct: 1177 FSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 483 QKLLQ*IWNILEVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRA 659 Q++ + V++P D+T N +GF ++ + + E+ L I G+E+ V+ Sbjct: 1174 QEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQSV 1233 Query: 660 TP 665 P Sbjct: 1234 LP 1235 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 37.5 bits (83), Expect = 0.010 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 265 GEIESINVKTDPNTGRSRGFAFIVFKAPESI 357 G +E++ + TD NTG+ R F F+ F +P S+ Sbjct: 481 GPLENVRIPTDKNTGQQRSFGFVEFSSPVSV 511 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 37.1 bits (82), Expect = 0.014 Identities = 23/70 (32%), Positives = 37/70 (52%) Frame = -2 Query: 380 SPAAMTLSIDSGALNTMKANPRDLPVFGSVFTLILSISPYAPNDHGAPYLWSPSSAHQQK 201 SP A++ +D G +A +++P F TL L + P+A G P ++PSS H++ Sbjct: 371 SPDALSKGLDMGWGALSRAGVQEMPAFP---TLRLPLHPFASTGFGTPAFYNPSSYHRE- 426 Query: 200 VFCRHRVLGP 171 + VLGP Sbjct: 427 ---YYPVLGP 433 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.9 bits (79), Expect = 0.031 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +1 Query: 277 SINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKAR 429 S+ V TD TGR RGF F+ F + + +DK + + ++ + ++ KA+ R Sbjct: 37 SVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPR 88 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPGG 686 +L V++ D+ + +GF F+TF SE ++ + K + G+ + V +A P+ + GG Sbjct: 35 LLSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPRGERGGG 94 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/64 (23%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Frame = +3 Query: 504 WNILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGP 680 +++++V++ D+ + +GF F+TF S++ + D + + + G+ + V +A + Sbjct: 253 YDVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSREQRG 312 Query: 681 GGIG 692 GG G Sbjct: 313 GGRG 316 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKAR 429 F Y ++ + V +D T R RGFAF+ F + +++ D + + + ++ +A++R Sbjct: 250 FSRY-DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSR 308 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 34.7 bits (76), Expect = 0.072 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 5/88 (5%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKK----- 417 F G I + DP +G ++GFAF F + + ++NK++ P K Sbjct: 172 FEECGHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAV----KKLDNKEIRPGKRLGVC 227 Query: 418 AKARHGKIFVGGLSSEISDDEIRNFFSE 501 + ++FVG + S EI FS+ Sbjct: 228 ISVANSRLFVGSIPKTKSKQEILEEFSK 255 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 34.7 bits (76), Expect = 0.072 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGG+ E DD +R FF++FG Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFG 34 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 34.3 bits (75), Expect = 0.096 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 268 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 ++ + V TD TGR RGF F+ F + E ++K + Sbjct: 29 DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAI 62 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/62 (25%), Positives = 36/62 (58%), Gaps = 2/62 (3%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GP 680 ++++V++ D+ + +GF F+TF S E++ + + + G+ + V +A P+ + G Sbjct: 29 DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQAQPRGERGA 88 Query: 681 GG 686 GG Sbjct: 89 GG 90 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 34.3 bits (75), Expect = 0.096 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F G + V +P G SRGFAF+ + E +K G+ N ++VE + + Sbjct: 226 FSQTGNVTFAQVAINPANGGSRGFAFVDYATAEEAEK----GQRAHNGRQVEGSNIRVAY 281 Query: 433 G 435 G Sbjct: 282 G 282 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 7/89 (7%) Frame = +1 Query: 265 GEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVEPKKAKARH--- 432 G + ++++ D T +G+ F+ F E D + + K + KA A + Sbjct: 37 GPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNL 96 Query: 433 ---GKIFVGGLSSEISDDEIRNFFSEFGI 510 +F+G L +E+ + + + FS FG+ Sbjct: 97 DVGANLFIGNLDTEVDEKLLYDTFSAFGV 125 Score = 32.7 bits (71), Expect = 0.29 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +1 Query: 250 SFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN 393 +F A+G I ++ + D +TG S+GFAFI F + ++ D + A G++ N Sbjct: 119 TFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCN 169 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +3 Query: 516 EVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 EV + D KN+ KGF F++F E + + TIGGK+V A K Sbjct: 541 EVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARK 592 Score = 30.7 bits (66), Expect = 1.2 Identities = 25/98 (25%), Positives = 42/98 (42%), Gaps = 22/98 (22%) Frame = +1 Query: 280 INVKTDPNTGRSRGFAFIVF-------KAPESIDKVMAAGEHTINN---KKVEPKKAK-- 423 + V DP +S+GF F+ F KA +D V G+ N +K P + K Sbjct: 542 VRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQTKPL 601 Query: 424 ----------ARHGKIFVGGLSSEISDDEIRNFFSEFG 507 + ++VG L ++ D E++ FS++G Sbjct: 602 VWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYG 639 >SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) Length = 599 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/63 (23%), Positives = 36/63 (57%) Frame = +2 Query: 77 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHL 256 ND+ A D++ ++ + G+ +NGG D+ ++++ + D+ ++ D E+ DH+ Sbjct: 180 NDDSASDVSIEDIIYGDDDNGGDDNDNYDNDDDYDGDNYND---ENDDYDHNDVEMADHM 236 Query: 257 EHT 265 +H+ Sbjct: 237 DHS 239 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 33.5 bits (73), Expect = 0.17 Identities = 22/103 (21%), Positives = 50/103 (48%), Gaps = 17/103 (16%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES-------IDKVMAAGEH-----TIN 393 +F +G I I++ DP + +GFAF+ + PE+ ++ V+ G + N Sbjct: 121 AFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKVGRPSN 180 Query: 394 NKKVEP-----KKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 + P ++ ++ +I++ + ++ +D+I++ F FG Sbjct: 181 VPQAAPLIEQFEQEAKKYARIYIASVHPDLLEDDIKSVFEAFG 223 Score = 31.5 bits (68), Expect = 0.67 Identities = 11/41 (26%), Positives = 26/41 (63%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 F A+G++ ++ +P TG+ +G+ FI ++ +S + +A+ Sbjct: 219 FEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIAS 259 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/75 (18%), Positives = 34/75 (45%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F G +ES+ + D TG +GF +++F++ +++ + +K+ +K + Sbjct: 76 FTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPSKDKP 135 Query: 433 GKIFVGGLSSEISDD 477 F+ + D+ Sbjct: 136 QTEFISHIQVRFRDN 150 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 671 N+ V + D+ KGF ++ FES+ V LK G+++ V + KP Sbjct: 81 NVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPSKDKP 135 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQ 590 I+ V + DK ++KGFCF+ +E ++ Sbjct: 5 IVNVNLVRDKKTGKQKGFCFLCYEDQR 31 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 33.1 bits (72), Expect = 0.22 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQ 590 I+ V + DK ++KGFCF+ +E ++ Sbjct: 5 IVNVNLVRDKKTGKQKGFCFLCYEDQR 31 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 F YG++ I + D NT SRGFAF+ F + M Sbjct: 36 FKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAM 74 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 F YG++ + + D T SRG AFI+F +S +AA Sbjct: 30 FERYGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAVAA 70 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 357 +F +G +E +++ D +GRSRGF F++ ++ + I Sbjct: 28 AFEEFG-VEKVDILRDKESGRSRGFGFVLLQSADQI 62 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 31.5 bits (68), Expect = 0.67 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGL +I +DEI F FG Sbjct: 345 KVFVGGLPPDIDEDEIHASFCRFG 368 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 31.5 bits (68), Expect = 0.67 Identities = 26/112 (23%), Positives = 51/112 (45%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F +G++ +++ + G +GFAFI F++ + + V+ KK E K+ + Sbjct: 108 FSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVVQMFNRESKTKK-EEKREPSID 166 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFGIS*KWRCPLTKQRTKERASVSSHLNLS 588 K + S+ ++ + S+ +S R ++RT SV S+ N S Sbjct: 167 DKTKIKKRRRSHSESDLES--SKLSLSQSER---KRRRTTSETSVDSNENAS 213 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 483 QKLLQ*IWNILEVEMPFDKTKNQRKGFCFITFESEQ 590 +K+ +L V +P K + KGF FI FES+Q Sbjct: 105 KKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQ 140 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 31.1 bits (67), Expect = 0.89 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 2/88 (2%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKA 426 SF +G + +++K P G+ +AF+ F + K A + I ++ ++ Sbjct: 256 SFEKFGVVLDVDIKR-PARGQGNTYAFVKFADLDVAAKAKCAMQGQCIGRNHIKIGYGRS 314 Query: 427 RHG-KIFVGGLSSEISDDEIRNFFSEFG 507 + +++VGGL IS E+ F FG Sbjct: 315 QQTTRLWVGGLGPWISIPELEREFDRFG 342 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 31.1 bits (67), Expect = 0.89 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 F +G+I V D T S+G AF+ +++ ES+ + +AA Sbjct: 436 FKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAA 476 >SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 77 NDNFAQDITTDNQLNGNAENGGGDSQDH-NSAEAPGRDDD 193 ND+ DI D+ NGN + G D+ D N E G DDD Sbjct: 20 NDDDGDDIDDDDG-NGNGNDNGDDNDDDDNDDEGNGDDDD 58 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFGI 510 +IFV G + E ++ E+R FF E+G+ Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGV 33 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 KIF+GGL + +++D+++ S FG Sbjct: 674 KIFIGGLPNYLNEDQVKELLSSFG 697 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 259 AYGEIESINVKTDPNTGRSRGFAF 330 ++GE+ + N+ D TG S+G+AF Sbjct: 695 SFGELRAFNLVKDSATGLSKGYAF 718 >SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +1 Query: 271 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVE 408 I+ + K+ N G++ G AF+VFK+ K + I ++ +E Sbjct: 361 IDLLKHKSGKNQGKNTGVAFVVFKSNNDASKALKMDRSYIGHRYIE 406 >SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -3 Query: 685 PPGPSGFGVARFTSTSFPPIVLL---GVLSKSFTTCSDSNVMKQKPFLWFFVLSK 530 P G +G G+ R++S S P G +S S+T V ++ FL FFVL K Sbjct: 383 PIGVNGSGITRYSSLSVPFYCKFSSHGDVSLSYTIKKSVPVWHEEKFLSFFVLYK 437 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKL--------FVGGLSWE 226 NN+N D +DN + N++N ++ D+N+ R D ++ ++ GL+WE Sbjct: 613 NNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSERGADPEIKRGKNPEGWIRGLNWE 671 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 193 NNDN + + +N N N N ++ D+NS + D Sbjct: 597 NNDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSDNNSD 636 >SB_10597| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=8.2e-34) Length = 728 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 314 DLPVFGSVFTLILSISPYAPNDHGAPYLWSPSSAHQQKVFC 192 D PV G+ F L P DH Y W H QK FC Sbjct: 45 DSPVLGT-FNFRLKGFTNPPTDHYGRYFWIEGDRHIQKGFC 84 >SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAE----NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKE 241 +ND D D+++NG + N GGD D + + DDD + G S++ D + Sbjct: 58 DNDGGDDDDDDDDEVNGGNDDDDFNNGGDCDDDDDDDDDDDDDDDDINKKGASYDDDDDD 117 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 F YGEI++++V D TG +G+A + ++ + + A Sbjct: 313 FSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEA 353 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTPKRTIGGKEVDVKRATP 665 +I +V++P D T ++ +GF F+ FE +E + + + G+ + V A P Sbjct: 30 DITDVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLAKP 83 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 351 +F +G+I + + D T + RGF F+ F+ E Sbjct: 24 AFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAE 57 >SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 193 NN+N + +N N N N ++ D NS E DDD Sbjct: 18 NNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDDDDDD 57 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +1 Query: 397 KKVEPK--KAKARHGKIFVGGLSSEISDDEIRNFFSEFGIS*KWRCPLTKQRTKER 558 KK++PK + + G I++G + ++EI+ FF +FG + R +K+ + + Sbjct: 84 KKIKPKGDEDELSPGVIYLGHIPHGFFENEIKKFFEQFGTVNRIRLSRSKKSARSK 139 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 384 F +G + I + + RS+G+AF+ F A + + K+ A H Sbjct: 118 FEQFGTVNRIRLSRSKKSARSKGYAFVEF-ACDEVAKIAADTMH 160 >SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) Length = 722 Score = 29.5 bits (63), Expect = 2.7 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -2 Query: 392 LMVCSPAAMTLSIDSGALNTMKANPRDLPVF-GSVFTLILSISPYAPNDHGAPYLWSPSS 216 L + P+A++ +I K P LPV G+ +T S N H YLW Sbjct: 525 LPITFPSAVSGTISPYLDIVNKYTPHGLPVVRGNEYTPHGSPVARGKNTHKTGYLWPRER 584 Query: 215 AHQQKVFCRH 186 H +V C H Sbjct: 585 IHTTRVTCCH 594 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +3 Query: 516 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 614 +V++ +D + Q KGFCF+T +++ + ++T Sbjct: 303 KVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQT 335 >SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAE-NGGGDSQDHNS 166 NND+ D T D+ N N + NGGG D+N+ Sbjct: 193 NNDDDDDDDTDDDDHNNNDDDNGGGGDDDNNN 224 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 77 NDNFAQDITTDNQLN-GNAENGGGDSQDHNS 166 +DNF DI+ D LN G A N + ++NS Sbjct: 335 HDNFNDDISNDGNLNGGGANNNNNKNNNYNS 365 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/52 (23%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 531 FDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPG 683 FD+ + +GF F+ ++ + +L + + G++V + A+P+ +G G Sbjct: 319 FDRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFASPRTEGGG 370 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +1 Query: 340 KAPESIDKVMAAGEHTINNKKVEPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGIS 513 K S + + E T KK P K + +F+G LS + ++ + FF E G+S Sbjct: 152 KEESSSESDSDSDEETPTPKKTVPAKEEM---SVFLGNLSFDADEETLAAFFEEKGLS 206 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 29.1 bits (62), Expect = 3.6 Identities = 22/101 (21%), Positives = 45/101 (44%), Gaps = 16/101 (15%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA-AGEHTI------------- 390 F G++ + + +D N+ RS+G A+I F ++ + +G+ + Sbjct: 166 FSKVGQVSDVRIISDRNSRRSKGIAYIEFTDKSAVPLAIGLSGQKLLGAPIMVMLTQAEK 225 Query: 391 NNKKVEPKKAKARHG--KIFVGGLSSEISDDEIRNFFSEFG 507 N E ++ K G +++VG L I++ ++ F FG Sbjct: 226 NRLAAEAERLKQPLGPTRLYVGSLHFNITEAMVKAVFEPFG 266 >SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) Length = 189 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 193 NN+N +I +N N N N ++ ++N+ + DDD Sbjct: 112 NNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNDDDDDDDD 151 >SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) Length = 244 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +2 Query: 71 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 193 A N+ +A+ +T +N N N N ++ ++N+ DDD Sbjct: 160 AINEKYAKIMTDNNNNNNNNNNNNNNNNNNNNNNNNNNDDD 200 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 271 IESINVKTDPNTGRSRGFAFIVFKAPES 354 + + V TD TGR RGF F+ +A ++ Sbjct: 107 VVDVRVITDRETGRPRGFGFVTLEAKKT 134 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 2/86 (2%) Frame = +1 Query: 256 GAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN--NKKVEPKKAKAR 429 GA+G + ++ + N ++ + KA E + V A + +K + K + Sbjct: 20 GAHGLLGALEISPHENYQQNGNSS--TNKAREISNNVAALPIDLVGEVSKDISKYKVVSN 77 Query: 430 HGKIFVGGLSSEISDDEIRNFFSEFG 507 K+FVG + ++ E+++FF FG Sbjct: 78 KCKVFVGNIGFKVRARELKDFFGYFG 103 >SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 193 ++DN D DN NG+ ++ D D + +A DDD Sbjct: 61 DSDNNYDDNDDDNDDNGDDDDNDDDDDDDDDDDADDDDDD 100 >SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 80 DNFAQDITTDNQLNGNAENGG-GDSQDHNSAEAPGRDDD 193 D + D D+ + + +N G GD D+ AE G DDD Sbjct: 821 DYYYDDDDDDDDDDDDGDNDGDGDGDDYGDAENYGEDDD 859 >SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -3 Query: 196 SVVIASWGLSTVMILRITATVLCISIKLV 110 ++++ S G++ L ITAT+LC SI L+ Sbjct: 267 TILLESSGVTLPKALHITATILCYSISLL 295 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 134 NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRD 250 NGG + D + A R++ +LFV GL E ++ +LR+ Sbjct: 603 NGGKSTDDASDAAYELRNEGVELFVVGLGDENSEAQLRE 641 >SB_11898| Best HMM Match : DMP1 (HMM E-Value=1.6) Length = 1705 Score = 28.3 bits (60), Expect = 6.3 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%) Frame = +1 Query: 376 GEHTINNKKVEPKKAKARHGKIFVGGLSSEIS-DDEIRN--FFSEFGIS*KWRCPLTKQR 546 GE+ ++ K EP+K K R + + ++S DDEI N S +C KQ Sbjct: 1010 GENLLSVSKEEPRKQKNRENYLSHVQATRDMSMDDEIPNKGRLRVNSDSVSSQCGKHKQN 1069 Query: 547 TKERASVSSHL 579 ++ A+ SSHL Sbjct: 1070 VQKNANDSSHL 1080 >SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) Length = 691 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAENGGGDSQD 157 +++++A D DN +NG+ ++GGGD D Sbjct: 585 DDEDYAGD--GDNDVNGDGDSGGGDDDD 610 >SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) Length = 557 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 193 +N+N +DI N EN GG+S + N + DD+ Sbjct: 147 SNNNEDEDIQEVEDDNEGKENDGGESDEENDDDDEDGDDE 186 >SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +1 Query: 262 YGEIESINVK---TDPNTGRSRGFAFIVFKAPESIDKVM 369 +GEIE PN G RG+ F+ FK E K + Sbjct: 410 FGEIEHFQFLFHGNGPNRGEPRGYCFVEFKKKEDARKAL 448 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 665 WCCTLHIDLLSTNCSFGSLKQIIYNL 588 WC D+L+T CS GS++ ++ L Sbjct: 3068 WCLDCRGDILATGCSDGSVEVVVARL 3093 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 27.9 bits (59), Expect = 8.3 Identities = 8/23 (34%), Positives = 18/23 (78%) Frame = +1 Query: 439 IFVGGLSSEISDDEIRNFFSEFG 507 ++VGGL ++++ ++R+ F +FG Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFG 328 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 200 LFVGGLSWETTDKELRDH 253 L+VGGL + T+++LRDH Sbjct: 306 LYVGGLEGKVTEQDLRDH 323 >SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGN--AENGGGDSQDHN 163 NNDN+ + DN N N NG DS D+N Sbjct: 90 NNDNYDNNGNNDNNDNYNNYDNNGNNDSNDNN 121 >SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) Length = 521 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 71 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 199 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 103 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 144 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 71 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 199 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 289 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 330 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,694,741 Number of Sequences: 59808 Number of extensions: 478685 Number of successful extensions: 2977 Number of sequences better than 10.0: 71 Number of HSP's better than 10.0 without gapping: 1529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2775 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -