BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00775 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 72 3e-13 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 72 3e-13 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 66 2e-11 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 59 2e-09 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 58 4e-09 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 57 1e-08 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 57 1e-08 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 57 1e-08 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 56 2e-08 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 54 1e-07 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 54 1e-07 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 52 3e-07 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 52 5e-07 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 40 4e-06 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 47 1e-05 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 47 1e-05 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 33 5e-05 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 45 6e-05 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 44 1e-04 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 42 5e-04 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 42 5e-04 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 42 5e-04 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 41 7e-04 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 41 7e-04 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 40 0.001 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 40 0.001 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 40 0.001 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 40 0.001 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 40 0.002 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 40 0.002 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 40 0.002 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 40 0.002 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 40 0.002 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 40 0.002 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 39 0.003 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 39 0.003 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 39 0.003 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 39 0.003 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 39 0.004 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 39 0.004 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 39 0.004 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 38 0.005 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 38 0.006 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 38 0.006 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 38 0.006 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 38 0.008 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 38 0.008 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 37 0.011 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 37 0.011 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 37 0.011 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 37 0.011 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 36 0.011 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 37 0.015 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 37 0.015 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 37 0.015 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 37 0.015 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 36 0.019 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 36 0.019 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 36 0.019 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 36 0.026 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 36 0.026 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 36 0.026 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 36 0.026 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 36 0.026 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 36 0.026 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 36 0.026 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 36 0.034 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 35 0.045 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 35 0.045 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 35 0.045 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 35 0.045 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 35 0.045 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 35 0.059 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 35 0.059 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 35 0.059 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 35 0.059 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 35 0.059 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 35 0.059 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 35 0.059 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 35 0.059 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 35 0.059 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 34 0.078 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 34 0.078 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 34 0.10 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 34 0.10 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 34 0.10 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 34 0.10 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 34 0.10 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 34 0.10 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 33 0.14 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 33 0.14 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 33 0.14 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 33 0.14 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 33 0.14 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 33 0.14 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.18 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 33 0.18 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 33 0.18 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 33 0.24 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 33 0.24 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 33 0.24 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 33 0.24 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 33 0.24 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 33 0.24 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 33 0.24 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 32 0.32 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 32 0.32 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 32 0.32 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 32 0.32 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 32 0.42 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 32 0.42 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 32 0.42 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 32 0.42 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 32 0.42 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 31 0.55 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 31 0.55 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 31 0.55 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 31 0.55 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 31 0.55 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 31 0.73 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 31 0.73 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 31 0.73 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 31 0.96 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 31 0.96 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 31 0.96 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 31 0.96 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 30 1.3 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 30 1.3 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 30 1.3 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 30 1.7 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 30 1.7 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 30 1.7 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 30 1.7 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 30 1.7 At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ... 29 2.2 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 29 2.2 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 2.2 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 29 2.2 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 29 2.2 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 2.2 At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ... 29 2.9 At2g47390.1 68415.m05915 expressed protein 29 2.9 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.9 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.9 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 29 2.9 At5g43420.1 68418.m05309 zinc finger (C3HC4-type RING finger) fa... 29 3.9 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 29 3.9 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 5.1 At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein ... 28 5.1 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 28 5.1 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 28 5.1 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 28 5.1 At5g22830.1 68418.m02669 magnesium transporter CorA-like family ... 28 6.8 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 28 6.8 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 28 6.8 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 28 6.8 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 28 6.8 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 28 6.8 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 27 9.0 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 27 9.0 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 27 9.0 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 27 9.0 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 27 9.0 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 27 9.0 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 27 9.0 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 27 9.0 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 27 9.0 At1g15890.1 68414.m01906 disease resistance protein (CC-NBS-LRR ... 27 9.0 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 72.1 bits (169), Expect = 3e-13 Identities = 40/96 (41%), Positives = 57/96 (59%), Gaps = 11/96 (11%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA--KA 426 FG YGEI + D +TG+ RGF FI F P +DKV+ H IN K+VE K+ K Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPKG 97 Query: 427 RHG---------KIFVGGLSSEISDDEIRNFFSEFG 507 G KIFVGG+ S +++DE+++FF+++G Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYG 133 Score = 46.8 bits (106), Expect = 1e-05 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 6/91 (6%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG------EHTINNKKVEPK 414 F YG + V D T RSRGF F++F + E +D++++ G + + KK EPK Sbjct: 129 FAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Query: 415 KAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 K+ R + S+D ++ +G Sbjct: 189 KSLNRSPPSYGSHPRGRSSNDSYASYGGPYG 219 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPK 668 N++E ++ D N+ +GF F+ F+SE+VV++LL K + +V++K+A PK Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 686 D+ Q +GF FITF VV+ +++ I GK+V++KR PK G GG Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK--GAGG 100 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 72.1 bits (169), Expect = 3e-13 Identities = 40/96 (41%), Positives = 57/96 (59%), Gaps = 11/96 (11%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA--KA 426 FG YGEI + D +TG+ RGF FI F P +DKV+ H IN K+VE K+ K Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPKG 97 Query: 427 RHG---------KIFVGGLSSEISDDEIRNFFSEFG 507 G KIFVGG+ S +++DE+++FF+++G Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYG 133 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 378 F YG + V D T RSRGF F++F + E +D++++ G Sbjct: 129 FAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 686 D+ Q +GF FITF VV+ +++ I GK+V++KR PK G GG Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK--GAGG 100 Score = 34.3 bits (75), Expect = 0.078 Identities = 14/34 (41%), Positives = 25/34 (73%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 608 N++E ++ D N+ +GF F+ F+SE+VV++LL Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 66.1 bits (154), Expect = 2e-11 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 9/94 (9%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 FG YGEI + D TG+ RGF F+ + +DKV+ H I K+VE K+ R Sbjct: 62 FGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVI-QDNHIIIGKQVEIKRTIPRG 120 Query: 433 G---------KIFVGGLSSEISDDEIRNFFSEFG 507 KIFVGG+ S + DDE + FF +FG Sbjct: 121 SMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFG 154 Score = 46.8 bits (106), Expect = 1e-05 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKVEPKKAKAR 429 F +GE++ + D +TGRSRGF F+ +++ + +D ++A G ++ +VE KKA+ + Sbjct: 150 FMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKR-TIGGKEVDVKRATPK 668 D + + +GF F+T+ESE +V+ LL R + G +V++K+A PK Sbjct: 164 DHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 34.3 bits (75), Expect = 0.078 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 D+ Q +GF F+T+ VV+ +++ I GK+V++KR P+ Sbjct: 76 DRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPR 119 Score = 31.1 bits (67), Expect = 0.73 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +2 Query: 92 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 253 +D D + + + E+ SQ H+ G D K+FVGGL+ ETT E H Sbjct: 11 EDEIHDPKPSEDIEDDDDKSQPHSGG---GVDSAGKIFVGGLARETTSAEFLKH 61 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 GKIFVGGL+ E + E F ++G Sbjct: 42 GKIFVGGLARETTSAEFLKHFGKYG 66 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 59.3 bits (137), Expect = 2e-09 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 12/97 (12%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPK------ 414 FG +GE+ + TD TG RGF F+ F +KV+ +H I+++KV+ K Sbjct: 86 FGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE-DHVIDDRKVDLKRTLPRG 144 Query: 415 ------KAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 KA ++ KIFVGGL + +DE++N+F +G Sbjct: 145 DKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYFCVYG 181 Score = 52.8 bits (121), Expect = 2e-07 Identities = 23/60 (38%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKAR 429 F YG+I + D +TGRSRGF F+ F+ +S+D++ + G+ H + +K+VE K+A+ + Sbjct: 177 FCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 44.4 bits (100), Expect = 7e-05 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDG 677 +I+E ++ +D + +GF F+TF++E V+ L K +G K+V++KRA PK G Sbjct: 182 DIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPKRTG 239 Score = 33.1 bits (72), Expect = 0.18 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = +2 Query: 101 TTDNQLNGNA--ENGG---GDSQDHNSAEAPGRDDDRKLFVGGLSWETT 232 T D++ NG A + GG S DH + + KLFVGG+SWETT Sbjct: 31 TFDDRRNGGAAVDTGGIQMKHSVDHRHSSS-SMSSPGKLFVGGVSWETT 78 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = +1 Query: 379 EHTINNKKVEPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 +H+++++ + + GK+FVGG+S E + + N+F +FG Sbjct: 50 KHSVDHR--HSSSSMSSPGKLFVGGVSWETTAETFANYFGKFG 90 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 D+ +GF F+TF V +L+ I ++VD+KR P+ D Sbjct: 100 DRITGNPRGFGFVTFADSAVAEKVLE-EDHVIDDRKVDLKRTLPRGD 145 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 58.4 bits (135), Expect = 4e-09 Identities = 41/113 (36%), Positives = 56/113 (49%), Gaps = 28/113 (24%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR- 429 FG YG++ + D TGR+RGF FIVF P ++V+ +H I+ + VE KKA R Sbjct: 35 FGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRD 93 Query: 430 ------------------HG---------KIFVGGLSSEISDDEIRNFFSEFG 507 HG KIFVGGL S I++ E +N+F +FG Sbjct: 94 DQQVLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFG 146 Score = 51.2 bits (117), Expect = 6e-07 Identities = 25/56 (44%), Positives = 32/56 (57%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +G I + V D NT R RGF FI F + ES+D V+ H +N K VE K+A Sbjct: 142 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRA 197 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/53 (41%), Positives = 33/53 (62%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 I +V + +D + +GF FITF+SE+ V+ +L + GK V+VKRA PK Sbjct: 148 IADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPK 200 Score = 35.1 bits (77), Expect = 0.045 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 +++E + D+T + +GF FI F V ++ K I G+ V+ K+A P+ D Sbjct: 40 DLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRDD 94 Score = 30.3 bits (65), Expect = 1.3 Identities = 9/38 (23%), Positives = 25/38 (65%) Frame = +1 Query: 394 NKKVEPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 N + + ++ + GK+F+GG+S + ++ ++ +F ++G Sbjct: 2 NPEEQKMESASDLGKLFIGGISWDTDEERLQEYFGKYG 39 Score = 30.3 bits (65), Expect = 1.3 Identities = 9/19 (47%), Positives = 17/19 (89%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDH 253 KLF+GG+SW+T ++ L+++ Sbjct: 16 KLFIGGISWDTDEERLQEY 34 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 57.2 bits (132), Expect = 1e-08 Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 25/110 (22%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR- 429 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + VE KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 430 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFG 507 HG KIFVGGL S I+++E +N+F +FG Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFG 134 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/56 (41%), Positives = 33/56 (58%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +G I + V D NT R RGF FI F + +++D+V+ H +N K VE K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/57 (38%), Positives = 33/57 (57%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 680 I +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 33.9 bits (74), Expect = 0.10 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLEH 262 KLF+GG+SW+T ++ LRD+ + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.1 bits (72), Expect = 0.18 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +1 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 57.2 bits (132), Expect = 1e-08 Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 25/110 (22%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR- 429 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + VE KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 430 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFG 507 HG KIFVGGL S I+++E +N+F +FG Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFG 134 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/56 (41%), Positives = 33/56 (58%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +G I + V D NT R RGF FI F + +++D+V+ H +N K VE K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/57 (38%), Positives = 33/57 (57%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 680 I +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 33.9 bits (74), Expect = 0.10 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLEH 262 KLF+GG+SW+T ++ LRD+ + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.1 bits (72), Expect = 0.18 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +1 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 57.2 bits (132), Expect = 1e-08 Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 25/110 (22%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR- 429 F YG++ + D TGR+RGF FIVF P ++V+ +H I+ + VE KKA R Sbjct: 26 FSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRD 84 Query: 430 ------------------HG------KIFVGGLSSEISDDEIRNFFSEFG 507 HG KIFVGGL S I+++E +N+F +FG Sbjct: 85 DQQVLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFG 134 Score = 49.6 bits (113), Expect = 2e-06 Identities = 23/56 (41%), Positives = 33/56 (58%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +G I + V D NT R RGF FI F + +++D+V+ H +N K VE K+A Sbjct: 130 FDQFGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/57 (38%), Positives = 33/57 (57%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 680 I +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 33.9 bits (74), Expect = 0.10 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLEH 262 KLF+GG+SW+T ++ LRD+ + Sbjct: 7 KLFIGGISWDTDEERLRDYFSN 28 Score = 33.1 bits (72), Expect = 0.18 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +1 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 56.4 bits (130), Expect = 2e-08 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 21/107 (19%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K VE KKA R Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRD 84 Query: 433 G---------------------KIFVGGLSSEISDDEIRNFFSEFGI 510 KIFVGGL+S +++ E + +F++FG+ Sbjct: 85 DHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGM 131 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/56 (41%), Positives = 31/56 (55%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +G I + V D T R RGF FI + + E++DKV+ H +N K VE K A Sbjct: 126 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 34.7 bits (76), Expect = 0.059 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDH 253 KLF+GG+SWET++ LRD+ Sbjct: 7 KLFIGGISWETSEDRLRDY 25 Score = 34.3 bits (75), Expect = 0.078 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+F+GG+S E S+D +R++F FG Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFG 30 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 +LE + D+ + +GF F+ F V ++ K I GK V+ K+A P+ D Sbjct: 32 VLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDD 85 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 173 APGRDDDRKLFVGGLSWETTDKELRDH 253 +PG + +K+FVGGL+ T+ E + + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKY 125 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 56.4 bits (130), Expect = 2e-08 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 21/107 (19%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K VE KKA R Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRD 84 Query: 433 G---------------------KIFVGGLSSEISDDEIRNFFSEFGI 510 KIFVGGL+S +++ E + +F++FG+ Sbjct: 85 DHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGM 131 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/56 (41%), Positives = 31/56 (55%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +G I + V D T R RGF FI + + E++DKV+ H +N K VE K A Sbjct: 126 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 34.7 bits (76), Expect = 0.059 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDH 253 KLF+GG+SWET++ LRD+ Sbjct: 7 KLFIGGISWETSEDRLRDY 25 Score = 34.3 bits (75), Expect = 0.078 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+F+GG+S E S+D +R++F FG Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFG 30 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 +LE + D+ + +GF F+ F V ++ K I GK V+ K+A P+ D Sbjct: 32 VLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDD 85 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 173 APGRDDDRKLFVGGLSWETTDKELRDH 253 +PG + +K+FVGGL+ T+ E + + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKY 125 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 56.0 bits (129), Expect = 2e-08 Identities = 24/61 (39%), Positives = 39/61 (63%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGI 689 + +V + +D+ N+ +GF F++F+SE V+ +L + GK+V+VKRA PK PGG Sbjct: 136 VTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKDANPGGG 195 Query: 690 G 692 G Sbjct: 196 G 196 Score = 54.4 bits (125), Expect = 7e-08 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 25/110 (22%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F YGE+ V D TGR RGF F++F P +D+V+ +H+I+ ++V+ K+A +R Sbjct: 26 FTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSRE 84 Query: 433 -------------------------GKIFVGGLSSEISDDEIRNFFSEFG 507 KIFVGGL ++D+E R +F +G Sbjct: 85 EQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEVYG 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/69 (31%), Positives = 36/69 (52%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F YG + + + D T R RGF F+ F + +++D V+ H ++ K+VE K+A + Sbjct: 130 FEVYGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKD 189 Query: 433 GKIFVGGLS 459 GG S Sbjct: 190 ANPGGGGRS 198 Score = 37.1 bits (82), Expect = 0.011 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +2 Query: 188 DDRKLFVGGLSWETTDKELRDH 253 D KLFVGG+SWET + +LR+H Sbjct: 4 DQGKLFVGGISWETDEDKLREH 25 Score = 33.5 bits (73), Expect = 0.14 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 GK+FVGG+S E +D++R F+ +G Sbjct: 6 GKLFVGGISWETDEDKLREHFTNYG 30 Score = 33.5 bits (73), Expect = 0.14 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 DK + +GF F+ F V++ +L+ K +I +EVDVKRA + + Sbjct: 40 DKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSREE 85 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Frame = +2 Query: 92 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRD---DDRKLFVGGLSWETTDKELRDHLE 259 +++ ++ + G + + N++ + G D +K+FVGGL TD+E R + E Sbjct: 73 REVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFE 131 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 23/108 (21%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA---- 420 F ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + VE KKA Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRD 84 Query: 421 -------------------KARHGKIFVGGLSSEISDDEIRNFFSEFG 507 R KIFVGGL S +++ + + +F +FG Sbjct: 85 DQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFG 132 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +3 Query: 516 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 683 +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK PG Sbjct: 136 DVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPG 191 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/55 (30%), Positives = 33/55 (60%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 ++E + D+T + +GF F+ F ++ V +++ T K I G+ V+ K+A P+ D Sbjct: 32 VIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEKHNIDGRLVEAKKAVPRDD 85 Score = 33.5 bits (73), Expect = 0.14 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +2 Query: 182 RDDDRKLFVGGLSWETTDKELRDH 253 + D+ KLF+GG+SW+T ++ L+++ Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEY 25 Score = 33.5 bits (73), Expect = 0.14 Identities = 10/26 (38%), Positives = 21/26 (80%) Frame = +1 Query: 430 HGKIFVGGLSSEISDDEIRNFFSEFG 507 +GK+F+GG+S + +++ ++ +FS FG Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFG 30 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 125 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHLE 259 N N S S PGR RK+FVGGL T+ + + + E Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYFE 129 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/108 (30%), Positives = 54/108 (50%), Gaps = 23/108 (21%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA---- 420 F ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + VE KKA Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRD 84 Query: 421 -------------------KARHGKIFVGGLSSEISDDEIRNFFSEFG 507 R KIFVGGL S +++ + + +F +FG Sbjct: 85 DQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFG 132 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/56 (39%), Positives = 33/56 (58%) Frame = +3 Query: 516 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 683 +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK PG Sbjct: 136 DVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPG 191 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/55 (30%), Positives = 33/55 (60%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 ++E + D+T + +GF F+ F ++ V +++ T K I G+ V+ K+A P+ D Sbjct: 32 VIEAVILKDRTTGRARGFGFVVF-ADPAVAEIVITEKHNIDGRLVEAKKAVPRDD 85 Score = 33.5 bits (73), Expect = 0.14 Identities = 10/24 (41%), Positives = 20/24 (83%) Frame = +2 Query: 182 RDDDRKLFVGGLSWETTDKELRDH 253 + D+ KLF+GG+SW+T ++ L+++ Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEY 25 Score = 33.5 bits (73), Expect = 0.14 Identities = 10/26 (38%), Positives = 21/26 (80%) Frame = +1 Query: 430 HGKIFVGGLSSEISDDEIRNFFSEFG 507 +GK+F+GG+S + +++ ++ +FS FG Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFG 30 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 125 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHLE 259 N N S S PGR RK+FVGGL T+ + + + E Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYFE 129 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 52.4 bits (120), Expect = 3e-07 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 25/110 (22%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F +GE+ + V + TGR RGF F+ F P ID+V+ +H I+N+ V+ K+A +R Sbjct: 26 FSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVL-QDKHHIDNRDVDVKRAMSRE 84 Query: 433 -------------------------GKIFVGGLSSEISDDEIRNFFSEFG 507 KIFVGGL ++ DE R +F +G Sbjct: 85 EQSPAGRSGTFNASRNFDSGANVRTKKIFVGGLPPALTSDEFRAYFETYG 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F YG + + D T R RGF F+ F + +S+D V+ H +N K+VE K+A Sbjct: 130 FETYGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRA 185 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 683 D+T + +GF F++F+SE V+ +L + GK+V+VKRA PK PG Sbjct: 144 DQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPKDANPG 193 Score = 35.5 bits (78), Expect = 0.034 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GPGG 686 +L+V + +K + +GF F+ F V++ +L+ K I ++VDVKRA + + P G Sbjct: 32 VLQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQD-KHHIDNRDVDVKRAMSREEQSPAG 90 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 188 DDRKLFVGGLSWETTDKELRDHLEH 262 D KLF+GG+SW+T + LR++ + Sbjct: 4 DQGKLFIGGISWDTDENLLREYFSN 28 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +1 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 GK+F+GG+S + ++ +R +FS FG Sbjct: 6 GKLFIGGISWDTDENLLREYFSNFG 30 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 51.6 bits (118), Expect = 5e-07 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 9/91 (9%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH--- 432 +G++E V D +TGRSRGF ++ F + E + GEH + N+ +E K A + Sbjct: 26 FGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKVATPKEEMR 84 Query: 433 ------GKIFVGGLSSEISDDEIRNFFSEFG 507 +IFV + S +S+ + R+ F +G Sbjct: 85 QPAKKVTRIFVARIPSSVSESDFRSHFERYG 115 Score = 44.4 bits (100), Expect = 7e-05 Identities = 24/55 (43%), Positives = 30/55 (54%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 I ++ MP D Q +G FITF S V DL++ +GG V V RATPK D Sbjct: 117 ITDLYMPKDYNSKQHRGIGFITFSSADSVEDLME-DTHDLGGTTVAVDRATPKED 170 Score = 33.5 bits (73), Expect = 0.14 Identities = 24/85 (28%), Positives = 34/85 (40%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 FG +G I+ + DP RGF F+ F D+V A H I ++V A Sbjct: 260 FGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRV-ARRSHEICGQEVAIDSATPLD 318 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 G SS +S +F +G Sbjct: 319 EAGPSAGASSMLSSSR-PEYFGGYG 342 Score = 32.7 bits (71), Expect = 0.24 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GP 680 +I + +P D ++ +GF F+TF +E V D + I G+EV + ATP + GP Sbjct: 265 HIQDAYIPKDPKRSGHRGFGFVTF-AENGVADRVARRSHEICGQEVAIDSATPLDEAGP 322 Score = 32.3 bits (70), Expect = 0.32 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 674 D++ + +GF ++TF S + + LK + +G + ++VK ATPK + Sbjct: 37 DRSTGRSRGFGYVTFASAEDAKNALK-GEHFLGNRILEVKVATPKEE 82 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 KIFVG L E S D++R++F FG Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFG 264 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +3 Query: 516 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 +V + D N+ +GF F+T++SE V ++++ + K V+VKRA PK Sbjct: 148 DVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPK 198 Score = 35.5 bits (78), Expect(2) = 4e-06 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +1 Query: 424 ARHGKIFVGGLSSEISDDEIRNFFSEFG 507 +R KIFVGGLSS +++E +++F FG Sbjct: 117 SRTKKIFVGGLSSNTTEEEFKSYFERFG 144 Score = 32.7 bits (71), Expect(2) = 4e-06 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F YG + V + TG+ RGF F+ F + K + H I K V+ +KA +H Sbjct: 26 FSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL-RDTHFILGKPVDVRKAIRKH 84 Score = 31.9 bits (69), Expect = 0.42 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGG++ E S++ ++ +FS +G Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYG 30 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 194 RKLFVGGLSWETTDKELRDHLE 259 +K+FVGGLS TT++E + + E Sbjct: 120 KKIFVGGLSSNTTEEEFKSYFE 141 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/56 (41%), Positives = 31/56 (55%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +G I + V D T R RGF FI + + E++DKV+ H +N K VE K A Sbjct: 53 FAQFGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 108 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 668 I +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 59 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 111 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +1 Query: 361 KVMAAGEHTINNKK---VEPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGI 510 K + +H + NK ++ + KIFVGGL+S +++ E + +F++FG+ Sbjct: 6 KAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGM 58 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +2 Query: 173 APGRDDDRKLFVGGLSWETTDKELRDH 253 +PG + +K+FVGGL+ T+ E + + Sbjct: 26 SPGPSNSKKIFVGGLASSVTEAEFKKY 52 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 46.8 bits (106), Expect = 1e-05 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 12/100 (12%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV------- 405 +F A+G I S V DP+ G+S+G+ F+ + E+ + +N+K+V Sbjct: 152 TFSAFGPILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVH 210 Query: 406 ----EPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGIS 513 +P K + ++V LS +SD+E+ F EFG++ Sbjct: 211 KLQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVT 250 Score = 31.5 bits (68), Expect = 0.55 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 F +G I S V DP+ G SRG F+ F PE + + Sbjct: 347 FAPFGTITSCKVMRDPS-GVSRGSGFVAFSTPEEATRAI 384 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 33.1 bits (72), Expect(2) = 5e-05 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +1 Query: 352 SIDKVMAAGEHTINNKKVEPKKA--KARHGKIFVGGLSSEISDDEIRNFFSEFG 507 S V+ AG H N ++ ++ + IFVGG+ ++ D+++R FS+FG Sbjct: 292 SSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFG 345 Score = 31.1 bits (67), Expect(2) = 5e-05 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVF 339 Y ++S V D NTGRS+G+ F+ F Sbjct: 226 YPSVKSAKVVIDSNTGRSKGYGFVRF 251 Score = 29.5 bits (63), Expect = 2.2 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 14/97 (14%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEP------- 411 F GE+ S+ V + T +S G+ F+ F + + ++V+ ++ +P Sbjct: 128 FSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEVLQNYSGSVMPNSDQPFRINWAS 187 Query: 412 ----KKAKARHG---KIFVGGLSSEISDDEIRNFFSE 501 +K +G +FVG LS +++D + FS+ Sbjct: 188 FSTGEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSD 224 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/63 (33%), Positives = 35/63 (55%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR 429 +F +YGEIE +V D +TGR +G+ F++FK + + + E + N+ V A + Sbjct: 427 AFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEK 486 Query: 430 HGK 438 GK Sbjct: 487 PGK 489 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR 429 +F YGE+ + D TGRSRGFAF+ F + E M ++ +++ A R Sbjct: 53 AFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/61 (24%), Positives = 34/61 (55%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGI 689 +++ ++ D+ + +GF F+TF S + ++ ++ + + G+ + V AT + G GG Sbjct: 60 VVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATERGSGFGGR 119 Query: 690 G 692 G Sbjct: 120 G 120 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 8/93 (8%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVE 408 F + ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 409 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 + + K+FVG L +S+ E+++ FS++G Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYG 130 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 41.5 bits (93), Expect = 5e-04 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 8/93 (8%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVE 408 F + ++ +N+ D T SRG F++ + E DK++ A G +++ K Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 409 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 + + K+FVG L +S+ E+++ FS++G Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYG 130 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 41.5 bits (93), Expect = 5e-04 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 14/101 (13%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-------------DKVMAAGEHTI 390 +F ++G I S V D TGRS+G+ F+ F+ ES DK + G Sbjct: 155 TFSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIR 213 Query: 391 NNKKVEPKKAKA-RHGKIFVGGLSSEISDDEIRNFFSEFGI 510 ++ + R ++V L EI +DE+R F +FG+ Sbjct: 214 RQERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGV 254 Score = 32.3 bits (70), Expect = 0.32 Identities = 26/93 (27%), Positives = 38/93 (40%), Gaps = 8/93 (8%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT--------INNKKVE 408 F + S+ V D N RS G+A+I F P + M A +T I + Sbjct: 69 FKHVANVVSVRVCRDQNR-RSLGYAYINFSNPNDAYRAMEALNYTPLFDRPIRIMLSNRD 127 Query: 409 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 P + G IF+ L + I + + FS FG Sbjct: 128 PSTRLSGKGNIFIKNLDASIDNKALFETFSSFG 160 Score = 31.9 bits (69), Expect = 0.42 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 351 F YG + S V +P G SRGF F+ + PE Sbjct: 352 FSEYGNVTSSKVMLNPQ-GMSRGFGFVAYSNPE 383 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 41.1 bits (92), Expect = 7e-04 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 402 F YGEI V D NTGRS+G+ F+ F+ PE+ + A I+ ++ Sbjct: 44 FEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRR 93 Score = 34.3 bits (75), Expect = 0.078 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET + LR H E Sbjct: 25 KVFVGGLAWETQSETLRQHFE 45 Score = 29.5 bits (63), Expect = 2.2 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 680 ILE + DK + KG+ F+TF + P I G+ + A+ P+P P Sbjct: 50 ILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRANCNLASLGRPRPPLP 109 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGL+ E + +R F ++G Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYG 48 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 F YG+I V TD NTGRS+G+ F+ F+ PE+ Sbjct: 44 FDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEA 77 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET + LR H + Sbjct: 25 KVFVGGLAWETQSETLRRHFD 45 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGL+ E + +R F ++G Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYG 48 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 662 +ILE + DK + KG+ F+TF + P I G+ + A+ Sbjct: 49 DILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGRRANCNLAS 100 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 40.3 bits (90), Expect = 0.001 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 19/105 (18%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 405 +F YGEIE D +G+S+G+ FI+FK+ + + I + Sbjct: 147 AFKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQKKIGTRMTACQLASIG 206 Query: 406 ----EPKKAKARH-------GKIFVGGLSSEISDDEIRNFFSEFG 507 P A A+H KI+V +S++I ++ FFS FG Sbjct: 207 PVQGNPVVAPAQHFNPENVQRKIYVSNVSADIDPQKLLEFFSRFG 251 Score = 36.3 bits (80), Expect = 0.019 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +GEIE + D TGR +GFA V+++ ES K + T + KA Sbjct: 247 FSRFGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCHKA 302 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 405 +F YGEI +V D +TGR++GF F++FK + + E + N+ V Sbjct: 182 AFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTV 233 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 677 I E + DK + KGF F+ F++ + LK P++ + + V A P G Sbjct: 189 ITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARPFNSG 244 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 170 EAPGRDDD-RKLFVGGLSWETTDKELRDHLE 259 E+ RD R +FV GL W+TT + L+ E Sbjct: 154 ESADRDSSQRNIFVRGLGWDTTHENLKAAFE 184 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 402 F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRK 86 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGL+ E DE+R +F +FG Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFG 41 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 680 ILE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 43 ILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPP 102 Query: 681 GGIG 692 G G Sbjct: 103 RGRG 106 Score = 31.5 bits (68), Expect = 0.55 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET E+R + E Sbjct: 18 KVFVGGLAWETPTDEMRRYFE 38 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/50 (34%), Positives = 29/50 (58%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 402 F +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRK 86 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGL+ E DE+R +F +FG Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFG 41 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 680 ILE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 43 ILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPP 102 Query: 681 GGIG 692 G G Sbjct: 103 RGRG 106 Score = 31.5 bits (68), Expect = 0.55 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET E+R + E Sbjct: 18 KVFVGGLAWETPTDEMRRYFE 38 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/56 (37%), Positives = 28/56 (50%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +GEI V D T RS+GF F+ F+ ES + HTI+ + V K A Sbjct: 29 FERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 Score = 30.7 bits (66), Expect = 0.96 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 659 I+ ++ D + KGF F+TF + + P TI G+ V+ K A Sbjct: 35 IVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 1/82 (1%) Frame = +1 Query: 265 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVEPKKAKARHGKI 441 GEI + + D ++G S+G+AF+ FK + K + K + ++ ++ ++ Sbjct: 140 GEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSETKN-RL 198 Query: 442 FVGGLSSEISDDEIRNFFSEFG 507 F+G + ++DE R + G Sbjct: 199 FIGNIPKNWTEDEFRKVIEDVG 220 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +1 Query: 271 IESINVKTDP-NTGRSRGFAFIVF 339 +E+I + DP NT R+RGFAF+++ Sbjct: 223 VENIELIKDPTNTTRNRGFAFVLY 246 Score = 27.5 bits (58), Expect = 9.0 Identities = 9/27 (33%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +1 Query: 430 HG-KIFVGGLSSEISDDEIRNFFSEFG 507 HG ++F+GGL ++ ++++R+ E G Sbjct: 114 HGSEVFIGGLPRDVGEEDLRDLCEEIG 140 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F AYG++E + D TG+SRGFA V+K E +A I+ K + K A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 34.3 bits (75), Expect = 0.078 Identities = 21/81 (25%), Positives = 40/81 (49%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F +YG++E V D TG+S+G+ F+ F +D + A + +KK++ + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 433 GKIFVGGLSSEISDDEIRNFF 495 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 677 ++ E + FDK + +GF +++ + L P + I GK ++ K A G Sbjct: 192 DVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F AYG++E + D TG+SRGFA V+K E +A I+ K + K A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 34.3 bits (75), Expect = 0.078 Identities = 21/81 (25%), Positives = 40/81 (49%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F +YG++E V D TG+S+G+ F+ F +D + A + +KK++ + + Sbjct: 95 FSSYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQL 149 Query: 433 GKIFVGGLSSEISDDEIRNFF 495 G S+I+D +R + Sbjct: 150 AASGNQGTGSQIADISMRKIY 170 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 677 ++ E + FDK + +GF +++ + L P + I GK ++ K A G Sbjct: 192 DVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKA 426 +F YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQS 86 Query: 427 R 429 R Sbjct: 87 R 87 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/61 (22%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 683 ++++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G G Sbjct: 33 DVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSRGSGGG 92 Query: 684 G 686 G Sbjct: 93 G 93 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKA 426 +F YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQS 86 Query: 427 R 429 R Sbjct: 87 R 87 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/61 (22%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 683 ++++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G G Sbjct: 33 DVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSRGSGGG 92 Query: 684 G 686 G Sbjct: 93 G 93 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVEPKKAKA 426 +F YGE+ V D TGRSRGF F+ F + E+ + A ++ + V+ A Sbjct: 59 AFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYAND 118 Query: 427 R-HGKIFVGG 453 R G F GG Sbjct: 119 RTSGGGFGGG 128 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGG 686 +++ + D+ + +GF F+TF S + + ++ R + G+ V V A + G GG Sbjct: 66 VVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYANDRTSG-GG 124 Query: 687 IG 692 G Sbjct: 125 FG 126 Score = 28.3 bits (60), Expect = 5.1 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+F+GG++ + +D +R F+++G Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYG 64 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 F +GEI V TD NTGRS+G+ F+ FK E+ Sbjct: 42 FEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 KIFVGGL+ E D +R +F +FG Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFG 46 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET +R + E Sbjct: 23 KIFVGGLAWETQRDTMRRYFE 43 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 399 F YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 683 I E + DK + KGF F+ F++ + + LK PK+ I + + A+ P G Sbjct: 130 IEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASG 187 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 170 EAPGRD-DDRKLFVGGLSWETTDKEL 244 EA RD RK+FV GL WETT + L Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETL 120 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 399 F YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 124 FEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 683 I E + DK + KGF F+ F++ + + LK PK+ I + + A+ P G Sbjct: 130 IEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASG 187 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 170 EAPGRD-DDRKLFVGGLSWETTDKEL 244 EA RD RK+FV GL WETT + L Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETL 120 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/85 (17%), Positives = 44/85 (51%), Gaps = 1/85 (1%) Frame = +1 Query: 256 GAYGEIESINVKTDPNTGRSRGFAFIVFKAPE-SIDKVMAAGEHTINNKKVEPKKAKARH 432 G+ GE+ + + + ++G +G+AF+ F++ + + + + K+++ +A+H Sbjct: 113 GSIGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIKCSTTQAKH 172 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 ++F+G + + +I+ + G Sbjct: 173 -RLFLGNVPRNWMESDIKKAANRIG 196 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +3 Query: 501 IWNILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRT-IGGKEV 644 I + EV + +K KG+ F+TF S+ + + + T T GK + Sbjct: 115 IGEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRI 163 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVEPKKAKA 426 +F YG + V D +GRSRGF FI F +++D+ +AA ++ + + KA+ Sbjct: 26 AFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQP 85 Query: 427 RHG 435 G Sbjct: 86 HQG 88 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 683 +++E ++ DK + +GF FITF+ ++ +++ + + G+ + V +A P G G Sbjct: 32 HLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQGGAG 91 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 3/37 (8%) Frame = +2 Query: 185 DDDRKLFVGGLSWETTDKELRDHLE---HTVK*RVLM 286 D + + F+GGL+W T+D+ LRD E H V+ +V++ Sbjct: 4 DPEYRCFIGGLAWTTSDRGLRDAFEKYGHLVEAKVVL 40 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 38.7 bits (86), Expect = 0.004 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 12/97 (12%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----EPKK 417 F + + +N+ + T RG F+ E DKV+ ++ +NKK P + Sbjct: 32 FREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQ 87 Query: 418 AKARHG-------KIFVGGLSSEISDDEIRNFFSEFG 507 K G K+FVG L +S+ E+++ FSE+G Sbjct: 88 VKYADGELERLEHKLFVGMLPKNVSETEVQSLFSEYG 124 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/86 (23%), Positives = 39/86 (45%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 FG GE+ + + +P T +S+G AF+ F E + + + + N K A + Sbjct: 234 FGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGVTASQDN 293 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFGI 510 +FVG + + + +R +G+ Sbjct: 294 DTLFVGNICKIWTPEALREKLKHYGV 319 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/56 (35%), Positives = 27/56 (48%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +GEI +NV D T RS+G+ F+ FK ES + TI + K A Sbjct: 33 FKRFGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLA 88 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 F YGEI +N+ D TG+S+GFAF+ ++ S Sbjct: 56 FSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 37.9 bits (84), Expect = 0.006 Identities = 25/95 (26%), Positives = 50/95 (52%), Gaps = 10/95 (10%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEHTINNK---K 402 F +G I S V T + G+SRG+ F+ F+ A ++++ + A + K K Sbjct: 132 FKKFGNIVSCKVATLED-GKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKK 190 Query: 403 VEPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 + K + ++ +++ L +++S+D +R F+EFG Sbjct: 191 TDRVKPEEKYTNLYMKNLDADVSEDLLREKFAEFG 225 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKV 366 F G I S + D G+S+GF F+ F P E+ID V Sbjct: 324 FSQCGTITSTKLMCDEK-GKSKGFGFVCFSTPEEAIDAV 361 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/94 (18%), Positives = 43/94 (45%), Gaps = 8/94 (8%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-------- 405 +F + + S+ + D ++GRS + + F + + + + +++ N K+ Sbjct: 43 AFAEFKSLTSVRLCKDASSGRSLCYGYANFLSRQDANLAIEKKNNSLLNGKMIRVMWSVR 102 Query: 406 EPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 P + G +FV L +++ +++ F +FG Sbjct: 103 APDARRNGVGNVFVKNLPESVTNAVLQDMFKKFG 136 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKA 426 +F ++GE+ V D TGRSRGF F+ F +S + + + +N +++ A Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLATE 113 Query: 427 R 429 R Sbjct: 114 R 114 Score = 31.1 bits (67), Expect = 0.73 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +2 Query: 110 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELR 247 N+L+G G S + G R KLFVGGLSW T D L+ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLK 52 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGLS D ++ F+ FG Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFG 59 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKA 426 +F ++GE+ V D TGRSRGF F+ F +S + + + +N +++ A Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLATE 113 Query: 427 R 429 R Sbjct: 114 R 114 Score = 31.1 bits (67), Expect = 0.73 Identities = 19/48 (39%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +2 Query: 110 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELR 247 N+L+G G S + G R KLFVGGLSW T D L+ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLK 52 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGLS D ++ F+ FG Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFG 59 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.1 bits (82), Expect = 0.011 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVE 408 F YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K Sbjct: 36 FAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Query: 409 PKKAKARHGKI 441 P K G++ Sbjct: 96 PNAEKISKGRV 106 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 37.1 bits (82), Expect = 0.011 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVE 408 F YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K Sbjct: 36 FAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG 95 Query: 409 PKKAKARHGKI 441 P K G++ Sbjct: 96 PNAEKISKGRV 106 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 402 F +GEI + TD TG+S+G+ F+ F+ +S + +A I+ +K Sbjct: 37 FDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRK 86 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +1 Query: 430 HGKIFVGGLSSEISDDEIRNFFSEFG 507 H K+FVGGL+ E DE+R +F +FG Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQFG 41 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGP 680 ILE + DK + KG+ F+TF + P I G++ + A+ P+P P Sbjct: 43 ILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKANCNIASFGRPRPSTP 102 Query: 681 GGIG 692 G G Sbjct: 103 RGRG 106 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET E+R + + Sbjct: 18 KVFVGGLAWETPTDEMRRYFD 38 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI-NNKKVEPKKAKAR 429 F G++ +++ DP T SRGF FI K+ ++ + + +H++ + + +KA+ R Sbjct: 95 FAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARRR 154 Query: 430 HGK 438 G+ Sbjct: 155 RGR 157 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 36.3 bits (80), Expect = 0.019 Identities = 15/55 (27%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 671 ++E + +D+ + KGF F+T++S Q V + +K+ + G+++ V A +P Sbjct: 230 VVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARP 284 Score = 33.1 bits (72), Expect(2) = 0.011 Identities = 19/61 (31%), Positives = 31/61 (50%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F + G +E + V D TGRSRGF F+ S+ +V AA + N +++ + + Sbjct: 111 FESAGNVEMVEVIYDKITGRSRGFGFVTM---SSVSEVEAAAQQ-FNGYELDGRPLRVNA 166 Query: 433 G 435 G Sbjct: 167 G 167 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/60 (21%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKVEPKKAKAR 429 F G++ V D ++GRS+GF F+ + + + + + + + ++ +++ +A+AR Sbjct: 224 FSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR 283 Score = 23.0 bits (47), Expect(2) = 0.011 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 +++VG LS + D + + FSE G Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQG 228 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 36.7 bits (81), Expect = 0.015 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA------GEHTINNKKVEP 411 +F +G+I + + +TGRSRGF FI F ++D+ + G+ I+ + EP Sbjct: 26 AFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEP 85 Query: 412 K 414 K Sbjct: 86 K 86 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +1 Query: 424 ARHG-KIFVGGLSSEISDDEIRNFFSEFG 507 A+ G +IFVGGLS E++D ++ FS FG Sbjct: 3 AKEGSRIFVGGLSPEVTDRDLERAFSRFG 31 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/55 (27%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 668 +IL+ ++ ++ + +GF FITF + +++ ++ R G + + V RA PK Sbjct: 32 DILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 36.7 bits (81), Expect = 0.015 Identities = 14/41 (34%), Positives = 25/41 (60%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 372 +F ++G++ V TD ++GRS+GF F+ + E +K A Sbjct: 53 AFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 36.7 bits (81), Expect = 0.015 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 14/92 (15%) Frame = +1 Query: 268 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEP-----------K 414 EI S+ V + N G S G+ F+ F++ + DKV+ T +P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 415 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 501 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 36.7 bits (81), Expect = 0.015 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 14/92 (15%) Frame = +1 Query: 268 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEP-----------K 414 EI S+ V + N G S G+ F+ F++ + DKV+ T +P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 415 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 501 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +1 Query: 439 IFVGGLSSEISDDEIRNFFSEFG 507 IFVGGL S ++D++++ F+EFG Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFG 328 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 372 Y + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 140 YSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 36.3 bits (80), Expect = 0.019 Identities = 20/53 (37%), Positives = 30/53 (56%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVE 408 +FG + V + NTGRSRGF FI F++ E++ +A T+N +VE Sbjct: 238 AFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSALA----TMNGVEVE 286 Score = 31.9 bits (69), Expect = 0.42 Identities = 20/79 (25%), Positives = 36/79 (45%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 FG G + + + D T RSRGF F+ + E + M N+ ++ + K Sbjct: 136 FGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAM----QMFNSSQIGGRTVKVNF 191 Query: 433 GKIFVGGLSSEISDDEIRN 489 ++ GG +E+ +IR+ Sbjct: 192 PEVPRGG-ENEVMRTKIRD 209 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDV 650 +++V++ +DK ++ +GF F+T S E+ + IGG+ V V Sbjct: 142 VVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 36.3 bits (80), Expect = 0.019 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 F YG + S+ V D GRSRGF F+ F PE+ K M Sbjct: 222 FSQYGTVSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 Score = 32.7 bits (71), Expect = 0.24 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAAGEHTINNKKVEPKKAKAR 429 FG YG+I S V N GRS+GF F+ F ES ++ K + + A+ + Sbjct: 324 FGCYGQIVSAKVMCHEN-GRSKGFGFVCFSNCEESKQAKRYLNGFLVDGKPIVVRVAERK 382 Query: 430 HGKI 441 +I Sbjct: 383 EDRI 386 Score = 27.5 bits (58), Expect = 9.0 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 12/97 (12%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES-------IDKVMAAGEHTINNKKVEP 411 F +G I S V + G+S+GF F+ F +S + M G+ K + Sbjct: 132 FCPFGSILSCKVVEE--NGQSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFVAKFINK 189 Query: 412 KKAKARHG-----KIFVGGLSSEISDDEIRNFFSEFG 507 + A G ++V L ++DD + FS++G Sbjct: 190 DERAAMAGNQDSTNVYVKNLIETVTDDCLHTLFSQYG 226 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 35.9 bits (79), Expect = 0.026 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 25/107 (23%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN---------NKKVE 408 YG ++ V D TGRS+G+ F+ F + M G++ NK Sbjct: 178 YGSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRIGPAANKNAL 237 Query: 409 PKK---------AKA-----RHGKIFVGGLSSEISDDEIRNFFSEFG 507 P + A A + IFVGGL + ++DDE+++ F +FG Sbjct: 238 PMQPAMYQNTQGANAGDNDPNNTTIFVGGLDANVTDDELKSIFGQFG 284 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.9 bits (79), Expect = 0.026 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR 429 +F YGEIE D +G+S+G+ FI++K+ + + I ++ + A Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLAS-- 216 Query: 430 HGKIFVG 450 G +F G Sbjct: 217 KGPVFGG 223 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 531 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 671 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.9 bits (79), Expect = 0.026 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR 429 +F YGEIE D +G+S+G+ FI++K+ + + I ++ + A Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLAS-- 216 Query: 430 HGKIFVG 450 G +F G Sbjct: 217 KGPVFGG 223 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 531 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 671 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 35.9 bits (79), Expect = 0.026 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKA 420 F +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKAR 429 +F YGEIE D +G+S+G+ FI++K+ + + I ++ + A Sbjct: 159 AFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLAS-- 216 Query: 430 HGKIFVG 450 G +F G Sbjct: 217 KGPVFGG 223 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 531 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 671 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVEPKKA 420 F G++ S V P T +S GF F+ F + E ++ ++A + +K+ KA Sbjct: 197 FSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 31.5 bits (68), Expect = 0.55 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAK 423 +G +E + V D +GRSR F F K+ E + V+ +N VE ++ K Sbjct: 99 HGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVV----EKLNGNTVEGREIK 148 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 402 F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ Sbjct: 27 FEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRR 76 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGL+ E +RN+F +FG Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFG 31 Score = 30.7 bits (66), Expect = 0.96 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET LR++ E Sbjct: 8 KVFVGGLAWETHKVSLRNYFE 28 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 402 F +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ Sbjct: 27 FEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRR 76 Score = 31.1 bits (67), Expect = 0.73 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+FVGGL+ E +RN+F +FG Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFG 31 Score = 30.7 bits (66), Expect = 0.96 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET LR++ E Sbjct: 8 KVFVGGLAWETHKVSLRNYFE 28 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 35.5 bits (78), Expect = 0.034 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKK 417 +FG YG I S V D + G+SR F F+ F+ PE + + A +N KK + K+ Sbjct: 244 TFGQYGSISSAVVMRDGD-GKSRCFGFVNFENPEDAARAVEA----LNGKKFDDKE 294 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 35.1 bits (77), Expect = 0.045 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNKKVEPKKAKA 426 F A+G +E + + DP TG+ +GF FI F E A G+ I + ++ Sbjct: 285 FEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIALNGKLEIAGRTIKVSSVSD 344 Query: 427 RHGKIFVGGLSSEISDDE 480 G S++ DD+ Sbjct: 345 HIGTQDSAPKSADFDDDD 362 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 35.1 bits (77), Expect = 0.045 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVF 339 +F ++GE+ + + D +GRSRGF F+ F Sbjct: 60 AFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+F+GGLS + + +++ FS FG Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFG 65 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRD 250 KLF+GGLSW ++ L+D Sbjct: 42 KLFIGGLSWSVDEQSLKD 59 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 35.1 bits (77), Expect = 0.045 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI 357 F +GE+ + D TGRS+GF F+ FK +S+ Sbjct: 64 FNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98 Score = 31.9 bits (69), Expect = 0.42 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGI 689 + + ++ D+ + KGF F+TF+ E D ++T + G+E+D + T + G G Sbjct: 70 VFDSKIIIDRETGRSKGFRFVTFKDE----DSMRTAIDRMNGQELDGRNITAQARGSGTR 125 Query: 690 G 692 G Sbjct: 126 G 126 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 35.1 bits (77), Expect = 0.045 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKA 426 +F YG+I + +TGR RGF FI F D + + NK + KA+ Sbjct: 31 TFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEP 90 Query: 427 RHG 435 + G Sbjct: 91 KVG 93 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPKPDG 677 I E ++ + + +GF FITF + +D +K R +G K + V +A PK G Sbjct: 38 ITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVGG 94 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 191 DRKLFVGGLSWETTDKEL 244 + ++FVGGLSW+ T+++L Sbjct: 11 ESRIFVGGLSWDVTERQL 28 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 35.1 bits (77), Expect = 0.045 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKA 426 +F YG+I + +TGR RGF FI F D + + NK + KA+ Sbjct: 31 TFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEP 90 Query: 427 RHG 435 + G Sbjct: 91 KVG 93 Score = 33.5 bits (73), Expect = 0.14 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPKPDG 677 I E ++ + + +GF FITF + +D +K R +G K + V +A PK G Sbjct: 38 ITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVGG 94 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +2 Query: 191 DRKLFVGGLSWETTDKEL 244 + ++FVGGLSW+ T+++L Sbjct: 11 ESRIFVGGLSWDVTERQL 28 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKA 426 +F +G++ + D +GRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQS 84 Query: 427 R 429 R Sbjct: 85 R 85 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/61 (22%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 683 ++++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G G Sbjct: 31 DVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGG 90 Query: 684 G 686 G Sbjct: 91 G 91 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKA 426 +F +G++ + D +GRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQS 84 Query: 427 R 429 R Sbjct: 85 R 85 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/63 (23%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 683 ++++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G G Sbjct: 31 DVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGG 90 Query: 684 GIG 692 G G Sbjct: 91 GGG 93 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKA 426 +F +G++ + D +GRSRGF F+ FK +++ D + ++ + + +A++ Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQS 84 Query: 427 R 429 R Sbjct: 85 R 85 Score = 34.7 bits (76), Expect = 0.059 Identities = 15/63 (23%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 683 ++++ ++ D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G G Sbjct: 31 DVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGG 90 Query: 684 GIG 692 G G Sbjct: 91 GGG 93 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 34.7 bits (76), Expect = 0.059 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLEH 262 KLF+GGLSW T D LRD H Sbjct: 36 KLFIGGLSWGTDDASLRDAFAH 57 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVF 339 +F +G++ V D TGRSRGF F+ F Sbjct: 54 AFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+F+GGLS D +R+ F+ FG Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFG 59 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 34.7 bits (76), Expect = 0.059 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLEH 262 KLF+GGLSW T D LRD H Sbjct: 36 KLFIGGLSWGTDDASLRDAFAH 57 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVF 339 +F +G++ V D TGRSRGF F+ F Sbjct: 54 AFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 K+F+GGLS D +R+ F+ FG Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFG 59 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 34.7 bits (76), Expect = 0.059 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +1 Query: 250 SFGAYGEIESI-NVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNK 399 +F A+G I S + DP+TG SRGF FI + + E+ D + + G++ N + Sbjct: 131 TFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQ 183 Score = 32.7 bits (71), Expect = 0.24 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 7/89 (7%) Frame = +1 Query: 265 GEIESINVKTDPNTGRSRGFAFIVFKAPESID---KVMAA----GEHTINNKKVEPKKAK 423 G + ++ V D T + + FI +++ E D KV+ G+ NK + KK+ Sbjct: 49 GPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVLNMIKLHGKPIRVNKASQDKKSL 108 Query: 424 ARHGKIFVGGLSSEISDDEIRNFFSEFGI 510 +F+G L ++ + + + FS FG+ Sbjct: 109 DVGANLFIGNLDPDVDEKLLYDTFSAFGV 137 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 34.7 bits (76), Expect = 0.059 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 24/110 (21%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE----SIDKV--MAAGEHTIN------ 393 +FG YG+I S V D +G SR F F+ F +PE +++K+ ++ GE + Sbjct: 244 TFGKYGDISSAVVMKD-QSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQK 302 Query: 394 --------NKKVEPKK----AKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 +K E ++ K + +++ L ++D++++ FSE+G Sbjct: 303 KSDREEELRRKFEQERISRFEKLQGSNLYLKNLDDSVNDEKLKEMFSEYG 352 Score = 31.5 bits (68), Expect = 0.55 Identities = 22/93 (23%), Positives = 41/93 (44%), Gaps = 8/93 (8%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKV-------E 408 F + ++ V D T RS G+A++ F PE + M + + I ++ + + Sbjct: 65 FNQVAPVHNLRVCRDL-THRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRD 123 Query: 409 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 P + G +F+ L + I + + FS FG Sbjct: 124 PSTRLSGKGNVFIKNLDASIDNKALYETFSSFG 156 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 351 F YG + S V + + G SRGF F+ + PE Sbjct: 348 FSEYGNVTSCKVMMN-SQGLSRGFGFVAYSNPE 379 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 34.7 bits (76), Expect = 0.059 Identities = 11/23 (47%), Positives = 19/23 (82%) Frame = +1 Query: 439 IFVGGLSSEISDDEIRNFFSEFG 507 +FVGGL + ++DD ++N FS++G Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYG 285 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 34.7 bits (76), Expect = 0.059 Identities = 11/23 (47%), Positives = 19/23 (82%) Frame = +1 Query: 439 IFVGGLSSEISDDEIRNFFSEFG 507 +FVGGL + ++DD ++N FS++G Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYG 285 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 34.3 bits (75), Expect = 0.078 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 +FG +GEI+++N+ D +G +G+A I ++ E ++A Sbjct: 114 AFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISA 155 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 34.3 bits (75), Expect = 0.078 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +1 Query: 439 IFVGGLSSEISDDEIRNFFSEFG 507 IFVGGL S ++D++++ FSEFG Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFG 330 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 223 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 33.9 bits (74), Expect = 0.10 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG--------EHTINNKKVE 408 F +G ++ + V + TG+S+ F FI F+ PE + +AAG EH + +E Sbjct: 80 FSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAE--IAAGAMNDYLLMEHMLKVHVIE 137 Query: 409 PKKAK 423 P+ K Sbjct: 138 PENVK 142 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 33.9 bits (74), Expect = 0.10 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPK 414 F +G + S V DPN G S+G F+ F PE + M+ ++ K +E K Sbjct: 152 FSPFGTVTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS----QLSGKMIESK 200 Score = 27.9 bits (59), Expect = 6.8 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +1 Query: 421 KARHGKIFVGGLSSEISDDEIRNFFSEFG 507 K + ++V L+ +DD+++N F E+G Sbjct: 25 KTKFTNVYVKNLAESTTDDDLKNAFGEYG 53 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 FG G ++SI + +TG+ RG A+ F E + +A KK+ ++ + Sbjct: 671 FGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKK 730 Query: 433 GK 438 GK Sbjct: 731 GK 732 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/62 (27%), Positives = 29/62 (46%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 FG G ++SI + +TG+ RG A+ F E + +A KK+ ++ + Sbjct: 671 FGDDGGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKK 730 Query: 433 GK 438 GK Sbjct: 731 GK 732 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 265 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 372 G ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 469 GAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 259 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 ++G + N+ D TG S+G+AF V++ P D AA Sbjct: 397 SFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 F +G++ V +D TGRSRGF F+ ++ +AA Sbjct: 227 FSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 Score = 31.1 bits (67), Expect = 0.73 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 14/99 (14%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVEPKKAKAR 429 F G +E V + +T +SRGF F+ E +K V +N +++ +A R Sbjct: 133 FEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPR 192 Query: 430 HG-------------KIFVGGLSSEISDDEIRNFFSEFG 507 +I+VG L ++ + FSE G Sbjct: 193 GSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHG 231 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 33.5 bits (73), Expect = 0.14 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 11/96 (11%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN----NKKVEPKKA 420 F +G + + + D TG+ +G F+ + + D+ + A + I V+ + A Sbjct: 140 FEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYA 199 Query: 421 ---KARHG----KIFVGGLSSEISDDEIRNFFSEFG 507 + R G K+FVG L+ + ++ E+ F +FG Sbjct: 200 DGERERIGTLEFKLFVGSLNKQATEKEVEEIFLQFG 235 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQ 590 N+LEV + DK Q++G CF+ + + + Sbjct: 145 NVLEVALIKDKRTGQQQGCCFVKYATSK 172 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 33.5 bits (73), Expect = 0.14 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 11/96 (11%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN----NKKVEPKKA 420 F +G + + + D TG+ +G F+ + + D+ + A + I V+ + A Sbjct: 140 FEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYA 199 Query: 421 ---KARHG----KIFVGGLSSEISDDEIRNFFSEFG 507 + R G K+FVG L+ + ++ E+ F +FG Sbjct: 200 DGERERIGTLEFKLFVGSLNKQATEKEVEEIFLQFG 235 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQ 590 N+LEV + DK Q++G CF+ + + + Sbjct: 145 NVLEVALIKDKRTGQQQGCCFVKYATSK 172 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFI 333 F GE+ ++V TD TG SRGFA+I Sbjct: 503 FSKCGEVTRVHVPTDRETGASRGFAYI 529 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +1 Query: 340 KAPESIDKVMAAGEHTINNKKVEPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 K ++ V A + K + + +F G LS +I+ +I NFF E G Sbjct: 353 KKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAG 408 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 33.5 bits (73), Expect = 0.14 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFK 342 SF A+ V D TGRSRGF F+ F+ Sbjct: 167 SFSAFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 33.5 bits (73), Expect = 0.14 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 +FG++G+I V D +G SRGF F+ + + E + M A Sbjct: 55 AFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA 96 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGG 686 I++ + D+ +GF F+T++S +V N+ ++ + + G+ + V A G GG Sbjct: 62 IVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPADSGGGGGGG 121 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 33.1 bits (72), Expect = 0.18 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFK 342 +F +G++ + D +GRSRGF F+ FK Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/43 (23%), Positives = 26/43 (60%) Frame = +3 Query: 507 NILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGG 635 ++++ ++ D+ + +GF F+TF+ E+ + D ++ + GG Sbjct: 31 DVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGSGGG 73 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 F +G++ V D TGRSRGF F+ + +++ ++A Sbjct: 264 FSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304 Score = 28.3 bits (60), Expect = 5.1 Identities = 23/99 (23%), Positives = 40/99 (40%), Gaps = 14/99 (14%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKA-PESIDKVMAAGEHTINNKKVEPKKAKAR 429 F G +E V + T +SRGF F+ + E+ V + +N + + KA R Sbjct: 170 FEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPR 229 Query: 430 HG-------------KIFVGGLSSEISDDEIRNFFSEFG 507 +++VG L ++ + + FSE G Sbjct: 230 GSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHG 268 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 33.1 bits (72), Expect = 0.18 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVEPKKAK 423 F + I+ + + D T SRGFAF+ F + E K + A T N K + AK Sbjct: 478 FSKHAPIKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAK 537 Query: 424 ARHG 435 + HG Sbjct: 538 SVHG 541 Score = 31.5 bits (68), Expect = 0.55 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 384 +G + + V + N+G SRGFAFI F ++ +M EH Sbjct: 321 WGPLHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/60 (23%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVEPKKAKAR 429 F G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 269 FNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 360 F + G +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 31.5 bits (68), Expect = 0.55 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 671 ++E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 275 VVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 329 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/60 (23%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVEPKKAKAR 429 F G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 277 FNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 360 F + G +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 31.5 bits (68), Expect = 0.55 Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 671 ++E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 283 VVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 337 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 32.7 bits (71), Expect = 0.24 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAK 423 F ++GEI + V TG S G+A+I K E +K + G H + + KA+ Sbjct: 258 FSSFGEITRVFVPPSHGTGGSLGYAYIDLK--EGAEKALELGRHDVGGWDLVVGKAE 312 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 F +GEI V TD +GRS+G+ F+ F+ E+ Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET + ++ H E Sbjct: 14 KVFVGGLAWETHKETMKKHFE 34 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 F +GEI V TD +GRS+G+ F+ F+ E+ Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET + ++ H E Sbjct: 14 KVFVGGLAWETHKETMKKHFE 34 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 32.7 bits (71), Expect = 0.24 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 F +GEI V TD +GRS+G+ F+ F+ E+ Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66 Score = 31.1 bits (67), Expect = 0.73 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVGGL+WET + ++ H E Sbjct: 14 KVFVGGLAWETHKETMKKHFE 34 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 32.7 bits (71), Expect = 0.24 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 372 F +G I S V D TGR+R FAF+ F + E D ++ Sbjct: 232 FSKFGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 271 Score = 31.1 bits (67), Expect = 0.73 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 25/110 (22%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEH--------- 384 F +G + S+ V +P TG SRG ++ A S+D G Sbjct: 128 FQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDM 187 Query: 385 ---TINNKKV---EPKKA---KARHGKIFVGGLSSEISDDEIRNFFSEFG 507 T N +V PKK +++H K++VG L D +RN FS+FG Sbjct: 188 NPGTRRNPEVLNSTPKKILMYESQH-KVYVGNLPWFTQPDGLRNHFSKFG 236 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 +F ++ + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 50 AFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 32.3 bits (70), Expect = 0.32 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 686 ++E ++ D+ ++ KGF F+TF S ++ L++ + + G+ + V A K GG Sbjct: 60 VVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAKQSLGGG 119 Query: 687 IG 692 G Sbjct: 120 GG 121 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVEPKKAKA 426 +F G++ + D + RS+GF F+ F + + K +M +N + + AKA Sbjct: 53 AFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKA 112 Query: 427 R 429 + Sbjct: 113 K 113 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 +F YG++ ++V D R +GFA++ F + E +K + Sbjct: 40 AFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKAL 79 Score = 31.1 bits (67), Expect = 0.73 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEV 644 +L+V++ DK + + KGF ++TF S E+ LL+ + + G+ V Sbjct: 47 VLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 32.3 bits (70), Expect = 0.32 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 405 F G++ +++ DP T SRGF FI K+ ++ + + +H++ +V Sbjct: 65 FAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRV 115 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +1 Query: 271 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAK 423 IE++ V DP+ +G A+++FK E+ + V+ G + +++ + K Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKGYLKLRERELRISRVK 363 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 31.9 bits (69), Expect = 0.42 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 409 PKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 P++ + GKIFVG L + I E FF +FG Sbjct: 157 PQQEFRQEGKIFVGNLPTWIKKPEFEEFFRQFG 189 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 31.9 bits (69), Expect = 0.42 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPK 414 +F YG + V D T RSRGF F+ + + + ++ + +N ++V K Sbjct: 22 AFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 77 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 31.9 bits (69), Expect = 0.42 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFK 342 SF + V D TGRSRGF F+ F+ Sbjct: 163 SFSVFSSCSDARVMWDQKTGRSRGFGFVSFR 193 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 31.9 bits (69), Expect = 0.42 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVF 339 F + GEI++++V D +TG S+G A++ F Sbjct: 425 FSSCGEIKNVSVPIDRDTGNSKGIAYLEF 453 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 31.5 bits (68), Expect = 0.55 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFGIS*KWRCPL 534 K++VGG+ + ++DEIR++F G+ K C + Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKM 194 Score = 27.5 bits (58), Expect = 9.0 Identities = 7/21 (33%), Positives = 17/21 (80%) Frame = +2 Query: 185 DDDRKLFVGGLSWETTDKELR 247 D ++++G L+W+TT++++R Sbjct: 259 DGYNRVYIGNLAWDTTERDIR 279 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 372 F +GE+ + TDP TG+ G A+I F E+ + ++ Sbjct: 536 FNKFGEVLKAFIVTDPATGQPSGSAYIEFTRKEAAENALS 575 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 F +G++ + V D +T +SRG AF+++ + E K + + I N + A + Sbjct: 77 FSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIAADN 136 Query: 433 GK 438 G+ Sbjct: 137 GR 138 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 31.5 bits (68), Expect = 0.55 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 256 GAYGEIESINVKTDPNTGRSRGFAFIVF 339 G Y ++ V D NTGRS+G+ F+ F Sbjct: 235 GRYPSVKGAKVVIDSNTGRSKGYGFVRF 262 Score = 30.7 bits (66), Expect = 0.96 Identities = 10/29 (34%), Positives = 22/29 (75%) Frame = +1 Query: 421 KARHGKIFVGGLSSEISDDEIRNFFSEFG 507 ++ + IFVGGL ++++++++ FS+FG Sbjct: 323 ESNNSTIFVGGLDADVTEEDLMQPFSDFG 351 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 31.5 bits (68), Expect = 0.55 Identities = 27/106 (25%), Positives = 45/106 (42%), Gaps = 21/106 (19%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----EPKK 417 F + + +N+ + T RG F+ E DKV+ ++ +NKK P + Sbjct: 32 FREFSIVNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQ 87 Query: 418 AKARHG----------------KIFVGGLSSEISDDEIRNFFSEFG 507 K G K+FVG L +S+ E+++ FSE+G Sbjct: 88 VKYADGELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYG 133 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 531 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 686 F +T+ G C F+ FE V + +K +GG++V ++ P P G G Sbjct: 289 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRG 342 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 531 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 686 F +T+ G C F+ FE V + +K +GG++V ++ P P G G Sbjct: 348 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRG 401 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 31.1 bits (67), Expect = 0.73 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +2 Query: 146 DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHLE 259 DS+D + +E+P +KLF+ GLS+ T++K LR E Sbjct: 267 DSRDQDDSESPPVKT-KKLFITGLSFYTSEKTLRAAFE 303 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 354 +F +GE+ + + D + RS+G+AF+ + E+ Sbjct: 301 AFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEA 335 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 30.7 bits (66), Expect = 0.96 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 351 F A+GEI + + D RS+G+AFI F + + Sbjct: 60 FSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQD 92 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 30.7 bits (66), Expect = 0.96 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 1/87 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVEPKKAKAR 429 F +G + + D +TG+SR F F+ F+ +S+ D +M VE ++K Sbjct: 27 FSKFGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDAIMI--------MDVEESRSKC- 77 Query: 430 HGKIFVGGLSSEISDDEIRNFFSEFGI 510 + VG ++ E++ +N +EF + Sbjct: 78 ---VNVGSITVEVARQRRKNRSAEFAL 101 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 30.7 bits (66), Expect = 0.96 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 12/90 (13%) Frame = +1 Query: 274 ESINVKTDPNTGRSRGFAFIVFKAPE-------SIDKVMAAGEHTINNKKVEPKKAK--- 423 E + V + +TG+SRGFAF+ E ++D G N +PK K Sbjct: 112 ELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKEPL 171 Query: 424 --ARHGKIFVGGLSSEISDDEIRNFFSEFG 507 K+FVG LS ++ + + F E G Sbjct: 172 YPETEHKLFVGNLSWTVTSESLAGAFRECG 201 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 +F G++ V D +TGRSRG+ F+ + + ++ + Sbjct: 196 AFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETAL 235 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 30.7 bits (66), Expect = 0.96 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFK 342 F Y V D TGRSRGF F+ F+ Sbjct: 159 FSVYPTCSDARVMWDQKTGRSRGFGFVSFR 188 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 372 +F +GE+ V TD +G S+GF F+ + E K +A Sbjct: 75 AFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIA 115 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 30.3 bits (65), Expect = 1.3 Identities = 25/106 (23%), Positives = 46/106 (43%), Gaps = 24/106 (22%) Frame = +1 Query: 262 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN---------NKK-- 402 Y ++ V D TGRS+G+ F+ F + M G++ + NKK Sbjct: 197 YSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQYCSSRPMRTGPAANKKPL 256 Query: 403 -VEPKKAKARHGK----------IFVGGLSSEISDDEIRNFFSEFG 507 ++P + G IFVG + +++D++++ F +FG Sbjct: 257 TMQPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDLKSVFGQFG 302 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 F +G + + V D TG SRGF F+ F + E + + Sbjct: 233 FHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAI 271 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 376 GEHTINNKKVEPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 507 GE NN E + + + VG +SS + D E++ F +FG Sbjct: 198 GERGGNNSVGELNRGEIPSRTLLVGNISSNVEDYELKVLFEQFG 241 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 402 F YG+I + +D T RS+G+ F+ FK ++ + IN ++ Sbjct: 37 FIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGRR 86 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDH 253 K+FVGGL+W+T + + DH Sbjct: 18 KVFVGGLAWDTHKEAMYDH 36 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 F +G+I+ + D T R +GF FI F + + K + Sbjct: 27 FSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKAL 65 Score = 28.3 bits (60), Expect = 5.1 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +3 Query: 510 ILEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGG 686 I E + D + KGF FITF+SE LK+ + + G+ + V+ A + G Sbjct: 33 IKEARLIRDSETQRPKGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEVAKNAEEVRAG 92 Query: 687 IGT 695 I + Sbjct: 93 INS 95 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +2 Query: 119 NGNAENGG--GDSQDHNSAEAPGRDDDR 196 +GN E G GD D++ + PG DDD+ Sbjct: 962 DGNHERGSESGDGDDYDDGDGPGSDDDK 989 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAA 375 F +GE+ES+++ T R G AF+ FK A S+ + AA Sbjct: 581 FTVFGEVESLSLVLHKVTKRPEGTAFVKFKTADASVAAISAA 622 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +1 Query: 250 SFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVEPKKAKA 426 +F G + + T+ + RGFAF+ F E +++ + T+ +++ K+A Sbjct: 39 AFSEVGPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAH 98 Query: 427 R 429 R Sbjct: 99 R 99 >At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 399 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKAR 429 F +G ++ + + + R F F+ F PE++ ++A G H + + +V K K + Sbjct: 176 FSTFGPVQDVRIPYQ----QKRMFGFVTFMYPETVKSILAKGNPHFVCHSRVLVKPYKEK 231 Query: 430 HGKI 441 GK+ Sbjct: 232 -GKV 234 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVF 339 F +YG I+ +++ TD T + +G+AFI + Sbjct: 158 FESYGPIKRVHLVTDQLTNKPKGYAFIEY 186 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 77 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 196 NDN + +N N N NGGG ++ S P R+ DR Sbjct: 119 NDNNGNNNNGNNNDNNNQNNGGG--SNNRSPPPPSRNSDR 156 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 74 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 166 NN N D +N N N +N G+++D+N+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNN 106 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 436 KIFVGGLSSEISDDEIRNFFSEFG 507 KIFVG L+ + D++R +F +FG Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFG 36 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 K+FVG L+W TT +LR + E Sbjct: 13 KIFVGNLTWRTTADDLRRYFE 33 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/63 (23%), Positives = 29/63 (46%) Frame = +1 Query: 319 GFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARHGKIFVGGLSSEISDDEIRNFFS 498 G I + I V+ + + ++ P + K++V GLS ++D +R+ F Sbjct: 39 GTGVISARRRRDIGGVLISSCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFE 98 Query: 499 EFG 507 +FG Sbjct: 99 QFG 101 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 197 KLFVGGLSWETTDKELRDHLE 259 KL+V GLS+ TT+ LRD E Sbjct: 78 KLYVSGLSFRTTEDTLRDTFE 98 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +3 Query: 534 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKE--VDVKRAT 662 D T + KGF F FES E ++ + +RTI G+E V+V +AT Sbjct: 237 DPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNVNQAT 282 >At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM), PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 540 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKAR 429 F +G ++ + + + R F F+ F PE++ ++A G H + + +V K K + Sbjct: 279 FSTFGPVQDVRIPYQ----QKRMFGFVTFVYPETVKSILAKGNPHFVCDSRVLVKPYKEK 334 Query: 430 HGKI 441 GK+ Sbjct: 335 -GKV 337 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 119 NGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRD 250 +G AE+GGG S SA A +DD G + E+RD Sbjct: 78 SGGAEDGGGTSNGSLSASATATEDDELAI--GTGYRLPPPEIRD 119 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 104 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHL 256 T NG GGG + + P R + ++ V GL + ++L+DH+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHM 139 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 104 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHL 256 T NG GGG + + P R + ++ V GL + ++L+DH+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHM 139 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 104 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHL 256 T NG GGG + + P R + ++ V GL + ++L+DH+ Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHM 139 >At5g43420.1 68418.m05309 zinc finger (C3HC4-type RING finger) family protein low similarity to RING-H2 zinc finger protein ATL4 [Arabidopsis thaliana] GI:4928399; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 375 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -3 Query: 691 PMPPGPSGFGVARFTSTSFP--PIVLLGVLSKSFTTCS 584 P PP P F A T TSFP + ++G+L+ +F S Sbjct: 16 PPPPPPPIFHRASSTGTSFPILAVAVIGILATAFLLVS 53 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 369 F +G + +V D T SRGF F+ F + E + + Sbjct: 194 FRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAI 232 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 534 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 659 D+ + KGF FITFESE LK + + G+ + V+ A Sbjct: 100 DQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETA 142 >At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 552 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVEPKKAKAR 429 F +G ++ + + + R F F+ F PE++ V+A G H I + +V K K + Sbjct: 280 FSLFGTVQDVRIPYQ----QKRMFGFVSFAHPETVKVVLARGNPHFICDSRVLVKPYKEK 335 Query: 430 HGKI 441 GK+ Sbjct: 336 -GKV 338 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 28.3 bits (60), Expect = 5.1 Identities = 22/85 (25%), Positives = 37/85 (43%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 FGAYGEI I + PN R + + E+ K + E K+E + Sbjct: 290 FGAYGEIREI--RETPNRRFHRFIEYYDVRDAETALKALNRSEIGGKCIKLELSRPGGAR 347 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 ++ V S ++ E+ NF+++ G Sbjct: 348 -RLSVPSQSQDLERTEVTNFYNQVG 371 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 28.3 bits (60), Expect = 5.1 Identities = 22/85 (25%), Positives = 37/85 (43%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVEPKKAKARH 432 FGAYGEI I + PN R + + E+ K + E K+E + Sbjct: 303 FGAYGEIREI--RETPNRRFHRFIEYYDVRDAETALKALNRSEIGGKCIKLELSRPGGAR 360 Query: 433 GKIFVGGLSSEISDDEIRNFFSEFG 507 ++ V S ++ E+ NF+++ G Sbjct: 361 -RLSVPSQSQDLERTEVTNFYNQVG 384 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +1 Query: 250 SFGAYGEIESI----NVKTDPNTGRSRGFAFIVFK 342 SF A+ S V D TGRSRGF F+ F+ Sbjct: 167 SFSAFNSCSSYYRDARVMWDQKTGRSRGFGFVSFR 201 >At5g22830.1 68418.m02669 magnesium transporter CorA-like family protein weak similarity to SP|Q01926 RNA splicing protein MRS2, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF01544: CorA-like Mg2+ transporter protein; supporting cDNA gi|12007446|gb|AF322255.1|AF322255 Length = 459 Score = 27.9 bits (59), Expect = 6.8 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 71 ANNDNFAQDITTDNQ-LNGNAENGGGDSQDHNSAEAPGRDDDRKL 202 A + A+D D + LN + ++ G DS + GRDD +K+ Sbjct: 65 AKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKI 109 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 259 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 259 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 259 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 375 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 27.9 bits (59), Expect = 6.8 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = +1 Query: 442 FVGGLSSEISDDEIRNFFSEFG 507 +VG L S+ +++++N FS+FG Sbjct: 11 YVGNLESDTEENDLKNAFSQFG 32 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +2 Query: 149 SQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHL 256 S ++++ AP R D ++ V GL + ++L+DH+ Sbjct: 94 SSSYSASRAPSRRSDYRVLVTGLPPSASWQDLKDHM 129 >At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 460 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +3 Query: 546 NQRKGFCF--ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 692 N+++GFCF + FE+ L+ TIG ++ V+ G G G Sbjct: 329 NKQQGFCFGFVEFETSSGKQSALEASPVTIGDRQAVVEEKKTNSRGGGNNG 379 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 360 F GEI+ I + D NT GF F++F + E + Sbjct: 54 FSRAGEIKKIIMGLDKNTKTPCGFCFVLFYSREDTE 89 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 439 IFVGGLSSEISDDEIRNFFSEFG 507 +FV G S +S+ ++ FSEFG Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFG 82 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 439 IFVGGLSSEISDDEIRNFFSEFG 507 +FV G S +S+ ++ FSEFG Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFG 82 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 439 IFVGGLSSEISDDEIRNFFSEFG 507 +FV G S +S+ ++ FSEFG Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFG 101 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 307 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 405 G SRGFAFI F++ +S + M + + +K+ Sbjct: 54 GESRGFAFIEFESADSAGRAMLHMDGRLIGQKI 86 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 27.5 bits (58), Expect = 9.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVF 339 F +G + + + D +G+ RGFAF+ F Sbjct: 67 FERFGPVRDVYIPRDYYSGQPRGFAFVEF 95 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 363 FG +GE+ + + D RG ++ FKA +K Sbjct: 118 FGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEK 154 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 253 FGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 363 FG +GE+ + + D RG ++ FKA +K Sbjct: 118 FGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEK 154 >At1g15890.1 68414.m01906 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 851 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/48 (29%), Positives = 28/48 (58%) Frame = -2 Query: 677 TIWFWCCTLHIDLLSTNCSFGSLKQIIYNLLRFKCDETEALSLVLCFV 534 T+ W +H+ L S++ F S+++ I +L+F D+ + + LCF+ Sbjct: 364 TVQEWQHVIHV-LNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFL 410 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,872,142 Number of Sequences: 28952 Number of extensions: 343128 Number of successful extensions: 1706 Number of sequences better than 10.0: 170 Number of HSP's better than 10.0 without gapping: 1225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1685 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -