BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00774 (768 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X81882-1|CAA57465.1| 780|Homo sapiens vasopressin activated cal... 32 2.0 BC063306-1|AAH63306.1| 780|Homo sapiens cullin 5 protein. 32 2.0 AF327710-1|AAK07472.1| 780|Homo sapiens cullin 5 protein. 32 2.0 AF017061-1|AAB70253.1| 781|Homo sapiens vasopressin-activated c... 32 2.0 >X81882-1|CAA57465.1| 780|Homo sapiens vasopressin activated calcium mobilizing receptor-like protein protein. Length = 780 Score = 32.3 bits (70), Expect = 2.0 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +2 Query: 548 CDICVRKTTTTYLLNTELANGQLFEPFEYSYYLFNQFFFINYHKSILNNFSLMHVLRD 721 CD+ +RKT + L +E +L E Y+ N+ F+ YHK+ L ++ + D Sbjct: 412 CDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISAD 469 >BC063306-1|AAH63306.1| 780|Homo sapiens cullin 5 protein. Length = 780 Score = 32.3 bits (70), Expect = 2.0 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +2 Query: 548 CDICVRKTTTTYLLNTELANGQLFEPFEYSYYLFNQFFFINYHKSILNNFSLMHVLRD 721 CD+ +RKT + L +E +L E Y+ N+ F+ YHK+ L ++ + D Sbjct: 412 CDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISAD 469 >AF327710-1|AAK07472.1| 780|Homo sapiens cullin 5 protein. Length = 780 Score = 32.3 bits (70), Expect = 2.0 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +2 Query: 548 CDICVRKTTTTYLLNTELANGQLFEPFEYSYYLFNQFFFINYHKSILNNFSLMHVLRD 721 CD+ +RKT + L +E +L E Y+ N+ F+ YHK+ L ++ + D Sbjct: 412 CDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISAD 469 >AF017061-1|AAB70253.1| 781|Homo sapiens vasopressin-activated calcium mobilizing putative receptor protein protein. Length = 781 Score = 32.3 bits (70), Expect = 2.0 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = +2 Query: 548 CDICVRKTTTTYLLNTELANGQLFEPFEYSYYLFNQFFFINYHKSILNNFSLMHVLRD 721 CD+ +RKT + L +E +L E Y+ N+ F+ YHK+ L ++ + D Sbjct: 413 CDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISAD 470 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,463,922 Number of Sequences: 237096 Number of extensions: 1500667 Number of successful extensions: 2704 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2704 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9255747988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -