BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00774 (768 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70783-1|CAA94852.2| 765|Caenorhabditis elegans Hypothetical pr... 29 2.8 AL021177-2|CAA15978.1| 192|Caenorhabditis elegans Hypothetical ... 29 2.8 >Z70783-1|CAA94852.2| 765|Caenorhabditis elegans Hypothetical protein ZK856.1 protein. Length = 765 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/71 (22%), Positives = 37/71 (52%) Frame = +2 Query: 512 RCLAVICNAH*GCDICVRKTTTTYLLNTELANGQLFEPFEYSYYLFNQFFFINYHKSILN 691 +C ++ N CD+ +RKT + L +E + +L + Y+ N+ F+ +H++ L+ Sbjct: 383 KCAELLANY---CDLLLRKTQLSKKLTSEEIDEKLNQVLLVLKYVENKDVFMRFHRAHLS 439 Query: 692 NFSLMHVLRDE 724 ++ + D+ Sbjct: 440 RRLILEMSADQ 450 >AL021177-2|CAA15978.1| 192|Caenorhabditis elegans Hypothetical protein Y1A5A.1 protein. Length = 192 Score = 29.5 bits (63), Expect = 2.8 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = +2 Query: 467 PFYKTKSLISPVFFFRC 517 P +++KS+I+PVF+F C Sbjct: 39 PLFESKSIITPVFYFNC 55 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,886,752 Number of Sequences: 27780 Number of extensions: 273995 Number of successful extensions: 662 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1840614650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -