BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00768 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 6e-12 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 47 2e-05 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 46 3e-05 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 45 6e-05 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 45 6e-05 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 42 3e-04 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.005 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 37 0.012 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 37 0.012 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 36 0.029 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.029 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 36 0.029 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 35 0.050 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) 34 0.088 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.088 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.088 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 33 0.27 SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 32 0.35 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.62 SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) 31 1.1 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.1 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 31 1.1 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 30 1.4 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 29 2.5 SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 29 2.5 SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) 29 2.5 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_6097| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.7) 29 2.5 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 29 3.3 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) 29 3.3 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 29 3.3 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 29 4.4 SB_14150| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_36189| Best HMM Match : ANATO (HMM E-Value=2.9) 29 4.4 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 28 5.8 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 28 5.8 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 28 5.8 SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 28 7.6 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 68.1 bits (159), Expect = 6e-12 Identities = 38/91 (41%), Positives = 46/91 (50%) Frame = +2 Query: 146 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVVISTFPEIGTQGKVEDSPS*GFSS 325 R PP IDGM SLKVDNLTYRTT EDL++VF++ G++ P + F Sbjct: 7 RGPPEIDGMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYE 66 Query: 326 VVTLKKPWTRWTDECWTAGNFAFRWRDMVAP 418 + C A F FRWRDMV P Sbjct: 67 KRDAEDAMDCMDATCLMAEKFVFRWRDMVVP 97 Score = 67.3 bits (157), Expect = 1e-11 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 232 FRKVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRML 372 F+K DIYIPRDR T ESRGFAFVRF+E+RDAE+A+D MD L Sbjct: 36 FKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAMDCMDATCL 82 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/49 (40%), Positives = 33/49 (67%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 D+ + DR T+ RGFAFV F +++ E+A++ +DG+ DGR ++V A Sbjct: 257 DVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQA 305 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = +1 Query: 274 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 DR T RGF FV F + ++A+D DG LDGR ++V A Sbjct: 43 DRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKA 85 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/44 (45%), Positives = 29/44 (65%) Frame = +1 Query: 265 IPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 396 +P DR SRGFA+V + + + E+AL MDG +DG+E+ VQ Sbjct: 1188 LPTDRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQ 1231 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 D+ + DR T RGF FV F + + E+A+D DG+ DGR ++V A Sbjct: 32 DVKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQA 80 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/57 (35%), Positives = 33/57 (57%) Frame = +1 Query: 232 FRKVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 FR + I++ +D++T +S+GFAF+ F R DA A++ + G D L V+ A Sbjct: 201 FRPLGPISRIFLAKDKFTNQSKGFAFINFVHREDAARAIEVLSGFGYDHLILNVEWA 257 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 2/58 (3%) Frame = +1 Query: 235 RKVRRSCDIYIP-RDRYT-RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 R++ R + + P RD + R GFAF F +RRDAE+A+ +DGR + G+ RV++A Sbjct: 16 REIEREFETFGPLRDVWVARNPPGFAFCVFEDRRDAEDAVRELDGRYICGQRARVELA 73 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 44.8 bits (101), Expect = 6e-05 Identities = 21/48 (43%), Positives = 29/48 (60%) Frame = +1 Query: 259 IYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 + I DR T RGF FV F + + E+A+D DG+ LDGR ++V A Sbjct: 125 VNIITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEA 172 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/57 (33%), Positives = 35/57 (61%) Frame = +1 Query: 232 FRKVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 F + + + I RD+ TRESRG AF+ F +R+ A+ A+ ++ + + GR ++ +A Sbjct: 30 FERYGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAVAAVNKKQMFGRTIKCTIA 86 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = +1 Query: 286 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 R GFAF F +RRDAE+A+ +DGR + G+ +RV++A Sbjct: 65 RNPPGFAFCIFDDRRDAEDAVRELDGRYICGQRVRVELA 103 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/49 (42%), Positives = 27/49 (55%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 D+ IP D T + RGF FV F D A+D M+ L GR +RV +A Sbjct: 33 DVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLA 81 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = +1 Query: 274 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 DR + ESRGF FV + + A++ L M G +DGR++R+ A Sbjct: 320 DRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFA 362 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 ++++P+DR T+ +G+ FV F DA+ A+ M+ + G+ +RV A Sbjct: 41 NVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKA 89 Score = 34.3 bits (75), Expect = 0.088 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +1 Query: 265 IPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 I RD T S+GFAF+ F ++ A++ M+G+ L R + V A Sbjct: 132 IMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYA 177 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 37.1 bits (82), Expect = 0.012 Identities = 22/65 (33%), Positives = 35/65 (53%) Frame = +1 Query: 208 DA*RLTPRFRKVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 387 D+ L F K R +++ R+ GFAFV + + RDAEEA+ +DG + R + Sbjct: 16 DSSELERAFEKFGRLSKVWVARN-----PPGFAFVEYEDYRDAEEAVRELDGANVCDRTI 70 Query: 388 RVQMA 402 RV+ + Sbjct: 71 RVEFS 75 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 37.1 bits (82), Expect = 0.012 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGR 366 D+++ +D+ T+E+RG +V+F + A A + MDGR Sbjct: 51 DVWVVKDKATKENRGVCYVKFVKASSAALACEEMDGR 87 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 ++ + +D +S+GF FV F R DA +A+ MD + G++++ A Sbjct: 541 EVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWA 589 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +1 Query: 271 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 RDR T +S G+AFV + DA +A+ M+G L + L+V A Sbjct: 60 RDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA 103 Score = 31.9 bits (69), Expect = 0.47 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 289 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 393 E RG FVRF +R +A+ A+D ++ + L G +++ Sbjct: 151 EGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKL 185 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 35.9 bits (79), Expect = 0.029 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = +1 Query: 250 SCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 SC++ RD+ T ES +AF+ F + D E A MD ++D R + V + Sbjct: 148 SCEVI--RDQKTGESLQYAFIEFEKDEDCERAYFKMDNVLIDDRRIHVDFS 196 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 274 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 393 D T S+G+ FV+F E A+ A++ M+G L GR L++ Sbjct: 276 DSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 315 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +1 Query: 301 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 396 FAFV F + RDAE+A+ DG DG +RV+ Sbjct: 302 FAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVE 333 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 35.1 bits (77), Expect = 0.050 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 295 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 RG+ FV F + RDAE+A+ ++GR L G + V+ + Sbjct: 722 RGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFS 757 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +1 Query: 292 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 393 SRGF FV F DA+ A+ +++G+ + GR L++ Sbjct: 98 SRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKI 131 >SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) Length = 76 Score = 34.3 bits (75), Expect = 0.088 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +1 Query: 286 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 R+ R + FV F +R A +A+D ++G +DG +L V +A Sbjct: 32 RKIRDYGFVYFAKRESAVQAIDGINGAYIDGCKLEVSLA 70 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 34.3 bits (75), Expect = 0.088 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 393 ++ + RD+ T + +GF F+ + ++R A+D +G L GR +RV Sbjct: 7 NVNLVRDKKTGKQKGFCFLCYEDQRSTILAVDNFNGIKLGGRTIRV 52 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 34.3 bits (75), Expect = 0.088 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +1 Query: 289 ESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 387 +S+GF FV F +AEEA++ ++G+ + GR L Sbjct: 147 KSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL 179 Score = 31.1 bits (67), Expect = 0.82 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +1 Query: 292 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 S+GF FV F +A +A+ M+GR+L + L V +A Sbjct: 251 SKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALA 287 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 33.5 bits (73), Expect = 0.15 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +1 Query: 253 CDIYIPRDRYTRESRGFAFVRFFERRDAEEALDT---MDGRMLDGR 381 C++ + D TR SRGF FVRF + DA+ L T + GR+ + R Sbjct: 144 CEVKL--DPNTRRSRGFGFVRFKKDEDAKNVLSTSHRIQGRLCEVR 187 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +1 Query: 238 KVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 K++ Y DR ++ + +AFV F ER A +A++ DG+ +DG ++ +A Sbjct: 344 KLKEEYSQYGAVDR-VKKLKDYAFVHFTERDHALKAIEETDGKEMDGLKIEASLA 397 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 32.7 bits (71), Expect = 0.27 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 274 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 DR T + +G+ F + ++ A A+ ++G L+GR LRV A Sbjct: 59 DRETGKPKGYGFCEYKDQETALSAMRNLNGYELNGRALRVDSA 101 >SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 32.7 bits (71), Expect = 0.27 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 295 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 399 RG+AF+ + RD A DG+ +DGR + V + Sbjct: 47 RGYAFIEYEHERDMHAAYKHADGKKIDGRRIVVDV 81 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 32.3 bits (70), Expect = 0.35 Identities = 21/65 (32%), Positives = 33/65 (50%) Frame = +1 Query: 196 YLPNDA*RLTPRFRKVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLD 375 + N+ + +F V R I + R + + S+G+AFV F A+ A DTM M+ Sbjct: 109 FFENEIKKFFEQFGTVNR---IRLSRSKKSARSKGYAFVEFACDEVAKIAADTMHNYMMF 165 Query: 376 GRELR 390 GR L+ Sbjct: 166 GRLLK 170 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 31.9 bits (69), Expect = 0.47 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 292 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 393 SRGFAFV + +AE+ +GR ++G +RV Sbjct: 246 SRGFAFVDYATAEEAEKGQRAHNGRQVEGSNIRV 279 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 31.5 bits (68), Expect = 0.62 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 259 IYIPRDRYTRESRGFAFVRFFERRDAEEALDTMD 360 + I RD TRE++G+ +V+F + A AL+ D Sbjct: 82 VQIVRDHKTRENKGYGYVKFHKSSTAAMALENCD 115 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 31.5 bits (68), Expect = 0.62 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +1 Query: 193 SYLPNDA*RLTPR--FRKVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGR 366 +Y+P D T R F V + I R + + S GF FV + DA++A+D ++G Sbjct: 52 NYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGF 111 Query: 367 MLDGRELRV 393 + + L+V Sbjct: 112 TIGNKVLKV 120 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +1 Query: 274 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 393 D + +GFAFV + A+ AL+ M+G +L GR ++V Sbjct: 136 DPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKV 175 >SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) Length = 260 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +1 Query: 298 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 399 GF FV F +A +A + ++G ++DGR++ V + Sbjct: 125 GFGFVTFNTAAEANKAREKLNGTIVDGRKVEVSL 158 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 179 LKVDNLTYRTTPEDLRRVFERCGEV 253 L V +L + TT ++LR FE+CGE+ Sbjct: 238 LMVQDLDFDTTVDELREYFEKCGEL 262 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 292 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 SRGF FV + D E+ DG +GR L+V A Sbjct: 82 SRGFGFVTLENQEDLEDVTRKFDGFEYEGRRLKVAEA 118 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 396 ++ IP D+ T + R F FV F A + +DG L R + V+ Sbjct: 485 NVRIPTDKNTGQQRSFGFVEFSSPVSVHYASELLDGIRLYDRAINVK 531 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +1 Query: 220 LTPRFRKVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 387 L F K + + RD T+ SRGF F+ F + + + L++ + LDG+++ Sbjct: 124 LRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNS-GAQELDGKKM 178 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 274 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 399 D+ T S+ F FV + A+ A+ M+G + + L+VQ+ Sbjct: 296 DKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQL 337 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +1 Query: 274 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 399 D+ T S+ F FV + A+ A+ M+G + + L+VQ+ Sbjct: 311 DKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQL 352 >SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 462 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 286 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 399 ++S+G V+F +A A++ + G+ML R LRV+M Sbjct: 222 KKSKGMGTVQFETPMEAMNAVNLLHGKMLMDRALRVRM 259 >SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) Length = 193 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 448 CDRNDSCMAMRGDHIAPSEREVP--CRPTFVRPSCP 347 C+ +D C G+ P E E P CR T + SCP Sbjct: 27 CNSDDKCSP--GERCRPQENECPLKCRKTIKKKSCP 60 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 280 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 + + +GF F+R R AE A +D GR LRV+ A Sbjct: 82 FINKEKGFGFIRLDTRLHAEAAKAGLDMATRKGRTLRVRFA 122 >SB_6097| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.7) Length = 325 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Frame = +2 Query: 251 VVISTFPEIGTQGKVEDSPS*GFSSVVTLKKPWTR-WTDECWTAGNFAFRWRD 406 V++ P I G + P+ + + K P R WT G F ++WR+ Sbjct: 9 VLLCVIPHISGHGYLSIPPARNYCGALKDKGPCVRNWTPNELNCGGFVYQWRE 61 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 271 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 +DR T++S+G+ FV DA E M++GR+ V +A Sbjct: 43 KDRVTKKSKGYGFVT-MATSDAAELACKNKRPMIEGRQANVNLA 85 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/54 (38%), Positives = 28/54 (51%) Frame = +2 Query: 128 LKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVVISTFPEIGTQG 289 +K+S+ R P+I S V T TTPE+LR++ E G I TF QG Sbjct: 1522 MKLSF-RTGPQIGRTKSGFVATYTSGTTPEELRKISENAG---IKTFTNKMDQG 1571 >SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) Length = 292 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/35 (37%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +1 Query: 301 FAFVRFFERRDAEEALDTMDGR-MLDGRELRVQMA 402 +AFV+F+ + A A + ++G+ ++DG L+VQ A Sbjct: 80 YAFVKFYSAKAALRAKEEVNGKWLIDGNILKVQFA 114 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = +1 Query: 274 DRYTRESRGFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQMA 402 D T+ S+G AFV++ + L D G LDG L+V +A Sbjct: 450 DHLTQHSKGSAFVKYRSAESVTQCLAATDEDSEGLFLDGNRLQVDLA 496 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 286 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 393 ++ +G + F +RD + AL +DG L+G+ +R+ Sbjct: 130 KQRQGEGVIEFSCKRDLKRALKKLDGEELNGKRIRL 165 >SB_14150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 508 GCGYDCASNYDGGNETWTCACDRNDSC 428 GCGY C NY GN CD N C Sbjct: 174 GCGYGCDGNYGCGN-----GCDGNYGC 195 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +1 Query: 265 IPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 402 I RD+ + SRGF FV A++ M+ + GR + V +A Sbjct: 39 ILRDKESGRSRGFGFVLLQSADQIAPAIEKMNQSSVGGRNITVALA 84 >SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -1 Query: 481 YDGGNETWTCACD---RNDSCMAMRGDHIAPSEREVPCR 374 YDG T D ND + M G H AP R++ C+ Sbjct: 332 YDGDRNTQIALMDMPHENDVVVEMNGRHAAPRHRKIRCQ 370 >SB_36189| Best HMM Match : ANATO (HMM E-Value=2.9) Length = 199 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 295 YFPLCTDLWECRYHNFSAPF 236 YFP C +L CRYH SA F Sbjct: 144 YFPCC-ELGHCRYHTSSADF 162 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 301 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 399 F FV+F + A+EA+ GR+++G+++ V++ Sbjct: 82 FGFVQFETEKGADEAVAKEHGRIINGKKIDVRI 114 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 164 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVV 256 D + L V L+Y TT E L+ F + GE+V Sbjct: 26 DDIGKLFVGGLSYETTKESLKEYFSKYGELV 56 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 28.3 bits (60), Expect = 5.8 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 259 IYIPRDRYTRESRGFAFVRFFERRDAEEAL 348 + +PR ++ E +GFAF+ F ++ AE + Sbjct: 117 VSLPRFKHNGEIKGFAFIEFESKQQAEHVV 146 >SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +1 Query: 256 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGR----MLDGR 381 DI + +D+ T SRGF FV +A + L+ + M+DGR Sbjct: 438 DIRLIKDKVTGTSRGFCFVELATIEEATQLLELIAAMNPPFMIDGR 483 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 220 LTPRFRKVRRSCDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMD 360 LT F K I RD+ + +S+G+ FV F + D +A+ M+ Sbjct: 233 LTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDPNDFIKAMREMN 279 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,549,305 Number of Sequences: 59808 Number of extensions: 333394 Number of successful extensions: 1034 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1031 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -