BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00767 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 3.6 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 24 4.7 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 8.3 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.6 bits (51), Expect = 3.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 388 ISVVMSPTSLHREWHVSTSSVGEFVKCDAN 299 + ++ P SL EW STS++ + D+N Sbjct: 157 VRLLKKPPSLDSEWKSSTSTIQLIEQLDSN 186 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 24.2 bits (50), Expect = 4.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 236 HCNHSFIAIPMELNLYNILFIG 171 HCNH F+ + + ++LF G Sbjct: 420 HCNHPFVFLIYDYGTRSVLFNG 441 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 8.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 677 LSVTEGGGVVLKNGSGEPVLAHAPTDI 757 L+VT G +VL + S E L H TD+ Sbjct: 304 LTVTCRGQIVLVSPSVEQFLGHCQTDL 330 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 813,861 Number of Sequences: 2352 Number of extensions: 17224 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -