BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00767 (798 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL033536-4|CAA22144.2| 1582|Caenorhabditis elegans Hypothetical ... 31 1.3 >AL033536-4|CAA22144.2| 1582|Caenorhabditis elegans Hypothetical protein Y53C10A.10 protein. Length = 1582 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +2 Query: 539 QLGVHSSHGPPPRYPRVIVGSAVIGLLFNAINYMLLAGRELSYSRRL-SVTEGGGVVLKN 715 +L +H S PP Y + S + G+ A N LAG E + V GGGVV++N Sbjct: 389 RLPIHPSTEPPLVYTLPQLKSVINGIPDGA-NITCLAGGETDTDVLIIEVLPGGGVVIRN 447 Query: 716 GS 721 G+ Sbjct: 448 GT 449 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,753,962 Number of Sequences: 27780 Number of extensions: 362559 Number of successful extensions: 843 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 843 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -