BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00763 (788 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 36 0.028 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 36 0.028 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 36 0.028 SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 36 0.037 SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) 34 0.15 SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 34 0.15 SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 31 0.80 SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) 31 1.4 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 30 2.5 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 29 3.2 SB_2062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_22756| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_26015| Best HMM Match : ANATO (HMM E-Value=3.2) 28 7.5 SB_43238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_53580| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/87 (27%), Positives = 41/87 (47%) Frame = +1 Query: 388 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTENTTGSFCCPRE 567 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + F PRE Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 568 QILRPLSLRCPGTVCLPWKRHCHNSPS 648 + L+ R L ++ N+P+ Sbjct: 151 VDMDSLTTRLDKEGKLHFEAKKRNAPA 177 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/87 (27%), Positives = 41/87 (47%) Frame = +1 Query: 388 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTENTTGSFCCPRE 567 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + F PRE Sbjct: 326 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 384 Query: 568 QILRPLSLRCPGTVCLPWKRHCHNSPS 648 + L+ R L ++ N+P+ Sbjct: 385 VDMDSLTTRLDKEGKLHFEAKKRNAPA 411 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 531 REYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 +E+ R F LP+G +K+ +S G L +EA Sbjct: 48 KEFRRTFTLPEGVEASNVKTRISNHGQLHIEA 79 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 531 REYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 +E+ R F LP+G +K+ +S G L +EA Sbjct: 282 KEFRRTFTLPEGVEASNVKTRISNHGQLHIEA 313 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/87 (27%), Positives = 41/87 (47%) Frame = +1 Query: 388 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTENTTGSFCCPRE 567 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + F PRE Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 568 QILRPLSLRCPGTVCLPWKRHCHNSPS 648 + L+ R L ++ N+P+ Sbjct: 151 VDMDSLTTRLDKEGKLHFEAKKRNAPA 177 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 531 REYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 +E+ R F LP+G +K+ +S G L +EA Sbjct: 48 KEFRRTFTLPEGVEASNVKTRISNHGQLHIEA 79 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/87 (27%), Positives = 41/87 (47%) Frame = +1 Query: 388 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTENTTGSFCCPRE 567 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + F PRE Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 568 QILRPLSLRCPGTVCLPWKRHCHNSPS 648 + L+ R L ++ N+P+ Sbjct: 151 VDMDSLTTRLDKEGKLHFEAKKRNAPA 177 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 531 REYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 +E+ R F LP+G +K+ +S G L +EA Sbjct: 48 KEFRRTFALPEGVEASNVKTRISNHGQLHIEA 79 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/87 (27%), Positives = 41/87 (47%) Frame = +1 Query: 388 QDEGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTENTTGSFCCPRE 567 + +GD K + DV+ + P+ I V+ + N+LLV A HE + + F PRE Sbjct: 92 ESKGDDK-FSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFVLPRE 150 Query: 568 QILRPLSLRCPGTVCLPWKRHCHNSPS 648 + L+ R L ++ N+P+ Sbjct: 151 VDMDSLTTRLDKEGKLHFEAKKRNAPA 177 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 531 REYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 +E+ R F LP+G +K+ +S G L +EA Sbjct: 48 KEFRRTFALPEGVEASNVKTRISNHGQLHIEA 79 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +3 Query: 531 REYNREFLLPKGTNPEAIKSSLSRDGVLTVEA---PLPQLAI 647 R++NR F+LP+ + + + L +DGVL +EA PL QL I Sbjct: 140 RQFNRHFVLPREVDMDTLVPRLGKDGVLYIEADKRPLRQLDI 181 Score = 31.9 bits (69), Expect = 0.61 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +3 Query: 501 RGESDTKSVYREYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 R ES+ +E+ R + LP+G + +I + ++ DG+L VEA Sbjct: 37 RHESEEGFDSKEFRRCYNLPEGVDESSISTRIAEDGMLHVEA 78 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 400 DGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHE 504 D L DVS + PEE+ VK ++L V A+ E Sbjct: 96 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQE 130 >SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) Length = 695 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/85 (27%), Positives = 36/85 (42%) Frame = +1 Query: 394 EGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTENTTGSFCCPREQI 573 E + DV + PE I V+ + N+LLV A HE + + F PRE Sbjct: 93 ESKDDKFSMAMDVKGFPPEAIKVQVLGNELLVSANHEVEHEGHYHAMHFNRQFILPREVD 152 Query: 574 LRPLSLRCPGTVCLPWKRHCHNSPS 648 + L+ R L ++ N+P+ Sbjct: 153 MDSLTTRLDKEGKLHFEAKKRNAPA 177 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 531 REYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 +E+ R F LP+G +K+ +S G L +EA Sbjct: 49 KEFRRTFTLPEGVEASNVKTRISNHGQLHIEA 80 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = +3 Query: 531 REYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 +E+ R F LP+G +PE + S +S G L +EA Sbjct: 48 KEFRRTFTLPEGIDPENVTSRISNHGHLHIEA 79 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = +1 Query: 418 LRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTENTTGSFCCPREQILRPLSLR 594 + DV+ + PE I V+ + N+LLV+A HE + + F PRE + L+ R Sbjct: 100 MAIDVAGFPPESIKVQVLGNELLVNANHEVEHEGHYHAMHFNRQFVLPREVDMDSLTTR 158 Score = 27.9 bits (59), Expect = 9.9 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +3 Query: 537 YNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 +NR+F+LP+ + +++ + L ++G L EA Sbjct: 140 FNRQFVLPREVDMDSLTTRLDKEGKLHFEA 169 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 480 ITGPRQTRGESDTKSVYREYNREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 I G ++ GE ++ E++R + LP G + + S ++ DG+L +EA Sbjct: 66 IDGKHKSEGEHGYET--SEFHRSYNLPDGVDVSTVSSRITGDGLLHIEA 112 Score = 31.5 bits (68), Expect = 0.80 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +3 Query: 540 NREFLLPKGTNPEAIKSSLSRDGVLTVEA 626 NR F+LPK + +++ S L +DG L +EA Sbjct: 160 NRHFVLPKDVDMDSLVSRLGKDGKLYIEA 188 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 394 EGDGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHE 504 EGD K DV Y PEEI +K ++ + KH+ Sbjct: 36 EGD-KVEIATLDVKNYRPEEISLKVEHGRIKIDGKHK 71 >SB_56656| Best HMM Match : VWA (HMM E-Value=3.8e-26) Length = 2157 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/78 (21%), Positives = 32/78 (41%) Frame = +1 Query: 220 NEEDGRRNEQIQSELMNRESNNFFKXXXXXXXXXQHSDSRQLAEPSHWDSLNSPLIQDEG 399 N++DG + ++ + + + DS + E + WD+ + D+G Sbjct: 1529 NQDDGTTGQNKKAPYSKDDQEQYQEGKVLDEGNGYDRDSHEGKEKNEWDNYDGD--NDDG 1586 Query: 400 DGKTLKLRFDVSQYTPEE 453 D KT++ D S Y E Sbjct: 1587 DSKTIEANKDKSVYHHSE 1604 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +1 Query: 400 DGKTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHE 504 D L DVS + PEE+ VK ++L V A+ E Sbjct: 24 DDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQE 58 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/41 (26%), Positives = 25/41 (60%) Frame = +2 Query: 173 VIDTEFSSIRERFDAEMRKMEEEMSKFNQNS*TEKATISSR 295 ++++E + +RE+ E+ +MEE M + + E+A+I + Sbjct: 836 LMESEITELREKHQQELGEMEERMKELQKQHDAEQASIKKK 876 >SB_2062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -1 Query: 686 DRSVLLDRNVPVRDGELWQWRFHGKHTVPGQRR 588 D S L++ +P++D L RF G VPG++R Sbjct: 444 DSSQALEKILPLQDKPLATVRFQGSRKVPGKKR 476 >SB_22756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/83 (27%), Positives = 32/83 (38%), Gaps = 5/83 (6%) Frame = +1 Query: 523 LCTENTTGSFCCPREQILRPLSLRCPGTVC-LPWKRHCHNSPSRTG----TFLSRSTERS 687 +CTE CPR + + RC T+C +P H ++ T L Sbjct: 65 VCTEEFLSLTVCPRHRDSYGIRYRCHKTLCSVPATFASHGKKAKVDKASITLLQSEQLFK 124 Query: 688 HHSPRVH*GSRYSITVNNLFLIY 756 V GSRY I + N+ L Y Sbjct: 125 QTGHLVPVGSRYRIDIMNIALPY 147 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/69 (23%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = +2 Query: 170 SVIDTEFSSIRERFDAEMRKMEEE---MSKFNQNS*TEKATISSRAQLARRHLHSIVTAD 340 ++I ++F + +R + E + N + T + +A+ HS+ T + Sbjct: 44 NIIGNSLKDNPKKFWSYVRSSKSESIGIPPLKNNDSSVSVTDAHKAETLNTFFHSVFTQE 103 Query: 341 SLPSPVTGI 367 LP+PV GI Sbjct: 104 QLPTPVLGI 112 >SB_26015| Best HMM Match : ANATO (HMM E-Value=3.2) Length = 474 Score = 28.3 bits (60), Expect = 7.5 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = -3 Query: 159 SLMGIFLLRPLSAIFHVICRVEIVETKQTLKRSRVNTFHWNNTHSTADKT 10 SL GI LL + + I ++E +E + KR R + +W+ TH + T Sbjct: 412 SLAGIVLLN--TQLLCCIVKLEKMEKGRAQKRKRKRSNYWDTTHQESTDT 459 >SB_43238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2532 Score = 27.9 bits (59), Expect = 9.9 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +1 Query: 430 VSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTENTTGSFCCPREQILRPLSLRCPG-T 606 +S + I+ +++ L H HE + I N C++ + S C R+++ R + G Sbjct: 2446 ISDVGKKAIIDACSESESLQHLFHESDPILNSCSKPHSLSICI-RDKLFRQKTTEKLGFP 2504 Query: 607 VCLPWKRHCHNSPSRTGTF 663 V P+KR+ + G F Sbjct: 2505 VHNPYKRYHRGVECKVGVF 2523 >SB_53580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 721 ICCLSGLVANDETAQCFWIGMFLSVMASCGNGASTVSTPS 602 + L+ +AN+ T + WIG F +V S G +S P+ Sbjct: 61 LATLTASIANNSTRKKLWIGAFFTVDISDGGWSSAGVLPA 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,848,148 Number of Sequences: 59808 Number of extensions: 474440 Number of successful extensions: 1380 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1373 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -