BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00763 (788 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.9 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 22 7.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 7.5 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 7.5 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 7.5 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 7.5 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 9.9 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 9.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 640 SCGNGASTVSTPSRDSEDL 584 SCG G + ++TP DS+ + Sbjct: 369 SCGGGPTILTTPGLDSDGI 387 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.8 bits (44), Expect = 7.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 634 HNSPSRTGTFLSRSTERSHHSP 699 HNSPS TG+ S + SP Sbjct: 59 HNSPSPTGSSPQHSGSSASTSP 80 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 406 KTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTE 534 K K DV PE++ + DNKL +A + N+I + T+ Sbjct: 74 KVGKKEADVVAVDPEDMYLAVKDNKLASNAGY--NVIEQVRTK 114 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 406 KTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTE 534 K K DV PE++ + DNKL +A + N+I + T+ Sbjct: 74 KVGKKEADVVAVDPEDMYLAVKDNKLASNAGY--NVIEQVRTK 114 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 7.5 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 406 KTLKLRFDVSQYTPEEIVVKTVDNKLLVHAKHEENLIRNLCTE 534 K K DV PE++ + DNKL +A + N+I + T+ Sbjct: 74 KVGKKEADVVAVDPEDMYLAVKDNKLASNAGY--NVIEQVRTK 114 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 480 FVVDSLNNDLF 448 F+VD L NDLF Sbjct: 96 FIVDRLRNDLF 106 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.4 bits (43), Expect = 9.9 Identities = 12/39 (30%), Positives = 14/39 (35%) Frame = +1 Query: 583 LSLRCPGTVCLPWKRHCHNSPSRTGTFLSRSTERSHHSP 699 L +R P L W N T T+ TE H P Sbjct: 346 LMMRRPKKTRLRWMMEIPNVTLPTSTYSGSPTELPKHLP 384 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 9.9 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 141 LLRPLSAIFHVICRVEIVETKQTLKRSRVNTF 46 L PL+ I H C I T+ + +R N F Sbjct: 287 LEEPLTTIQHNNCLTRIPSTRINKQHTRGNNF 318 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,916 Number of Sequences: 438 Number of extensions: 4212 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -