BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00762 (550 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 25 0.38 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 0.88 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 24 0.88 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 0.88 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 24 0.88 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 24 0.88 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 24 1.2 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 2.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 2.0 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 2.0 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 2.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 2.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 2.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 2.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 2.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 2.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 2.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 2.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 2.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 2.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 2.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 2.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 2.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 2.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 23 2.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 2.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 2.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 3.6 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 6.2 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 6.2 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 6.2 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 6.2 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 6.2 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 6.2 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 6.2 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 6.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 6.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 6.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 6.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 6.2 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 6.2 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 25.4 bits (53), Expect = 0.38 Identities = 16/59 (27%), Positives = 24/59 (40%) Frame = +3 Query: 174 QTRPSCSRRKNRQTREHLLVFFTNQRIEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTR 350 +T PS + R+ EH L F N + + +FL N ++K T Q R Sbjct: 192 ETFPSVYSKTRRRALEHTLDRFHNDKYSNVPYFLFGDFNFRTDTAGVIKKLTEDTQERR 250 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 0.88 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 201 KNRQTREHLLVFFT 242 KN QTREH L+ FT Sbjct: 129 KNGQTREHALLAFT 142 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.2 bits (50), Expect = 0.88 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 201 KNRQTREHLLVFFT 242 KN QTREH L+ FT Sbjct: 56 KNGQTREHALLAFT 69 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.2 bits (50), Expect = 0.88 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ RE Sbjct: 225 QHTSSRYSRERSCSRDRNREYRE 247 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.2 bits (50), Expect = 0.88 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 201 KNRQTREHLLVFFT 242 KN QTREH L+ FT Sbjct: 72 KNGQTREHALLAFT 85 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.2 bits (50), Expect = 0.88 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 201 KNRQTREHLLVFFT 242 KN QTREH L+ FT Sbjct: 129 KNGQTREHALLAFT 142 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 197 KEKSTNSRAFTCFLYQSKN*DH*FLPRPV 283 KEK R +C L + +N + FL RP+ Sbjct: 1 KEKHLTQRINSCDLLKKRNENDPFLKRPI 29 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ +E Sbjct: 214 QHTSSRYSRERSCSRDRNREYKE 236 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ +E Sbjct: 225 QHTSSHYSRERSCSRDRNREYKE 247 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ +E Sbjct: 225 QHTSSRYSRERSCSRDRNREYKE 247 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ +E Sbjct: 225 QHTSSRYSRERSCSRDRNREYKE 247 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 214 QHTSSRYSRERSCSRDRNREYRK 236 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSHYSRERSCSRDRNREYRK 247 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSHYSRERSCSRDRNREYRK 247 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSHYSRERSCSRDRNREYRK 247 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSHYSRERSCSRDRNREYRK 247 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 214 QHTSSHYSRERSCSRDRNREYRK 236 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 214 QHTSSRYSRERSCSRDRNREYRK 236 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 214 QHTSSRYSRERSCSRDRNREYRK 236 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 214 QHTSSRYSRERSCSRDRNREYRK 236 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 230 QHTSSRYSRERSCSRDRNREYRK 252 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 382 TVILVWV*SAARKSPL 429 T++LVW SAA SP+ Sbjct: 306 TILLVWAISAAIGSPI 321 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 6.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 187 LVREGKIDKLESIYLFSLPIKELRSLIS 270 + R + + YLFSL + +L LIS Sbjct: 78 IARNKSMHTATNYYLFSLAVSDLLLLIS 105 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 186 SCSRRKNRQTRE 221 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 153 ERVGSCYQTRPSCSRRKNRQTRE 221 + S Y SCSR +NR+ ++ Sbjct: 225 QHTSSRYSRERSCSRDRNREYKK 247 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,814 Number of Sequences: 438 Number of extensions: 3140 Number of successful extensions: 47 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -