BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00760 (664 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 41 0.001 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 40 0.001 SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) 40 0.001 SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) 40 0.001 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 40 0.001 SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9149| Best HMM Match : Lipase_GDSL (HMM E-Value=0.51) 38 0.006 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) 37 0.017 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 35 0.051 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 35 0.068 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 35 0.068 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 34 0.090 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.090 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) 33 0.21 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 33 0.21 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) 33 0.21 SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) 33 0.21 SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) 33 0.27 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 33 0.27 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.27 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.27 SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) 33 0.27 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.36 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 32 0.36 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 32 0.36 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 32 0.36 SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.36 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.36 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 32 0.36 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 32 0.36 SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) 32 0.36 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 32 0.36 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.36 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.36 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.36 SB_34392| Best HMM Match : Ank (HMM E-Value=5.2e-12) 32 0.36 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.36 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 32 0.36 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 32 0.36 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.36 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 32 0.48 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.48 SB_4451| Best HMM Match : Cornifin (HMM E-Value=0.11) 32 0.48 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 32 0.48 SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) 32 0.48 SB_39284| Best HMM Match : WW (HMM E-Value=7.9) 32 0.48 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 32 0.48 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 31 0.63 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 31 0.63 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 31 0.63 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 31 0.63 SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) 31 0.63 SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 31 0.63 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) 31 0.63 SB_38574| Best HMM Match : WW (HMM E-Value=4.9) 31 0.63 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 31 0.63 SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) 31 0.63 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 31 0.63 SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 31 0.84 SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) 31 0.84 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) 31 0.84 SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_5514| Best HMM Match : TB (HMM E-Value=4.3) 31 0.84 SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 31 0.84 SB_54439| Best HMM Match : SNF (HMM E-Value=0) 31 0.84 SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) 31 0.84 SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) 31 0.84 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 31 0.84 SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 31 0.84 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 31 1.1 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 31 1.1 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.5 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 30 1.5 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 30 1.5 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 30 1.5 SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) 30 1.5 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 30 1.5 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.5 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 30 1.5 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 30 1.5 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 30 1.5 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.5 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_31424| Best HMM Match : Sigma54_activat (HMM E-Value=6.2) 30 1.5 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.5 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 30 1.5 SB_3365| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 30 1.9 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 30 1.9 SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 29 2.6 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 29 2.6 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 29 2.6 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 29 2.6 SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) 29 2.6 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 29 2.6 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 29 3.4 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 29 3.4 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) 29 3.4 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 3.4 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 29 3.4 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 3.4 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 29 3.4 SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) 29 3.4 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 29 3.4 SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 29 3.4 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 29 3.4 SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.4 SB_13834| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 29 3.4 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 29 4.5 SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) 29 4.5 SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 29 4.5 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 29 4.5 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 29 4.5 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 29 4.5 SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 29 4.5 SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 29 4.5 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 29 4.5 SB_25475| Best HMM Match : DUF1279 (HMM E-Value=0.63) 29 4.5 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 29 4.5 SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) 29 4.5 SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) 29 4.5 SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 29 4.5 SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) 28 5.9 SB_4128| Best HMM Match : Luteo_Vpg (HMM E-Value=1.7) 28 5.9 SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) 28 7.8 SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) 28 7.8 SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 28 7.8 SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) 28 7.8 SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) 28 7.8 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 186 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 245 Query: 176 FQRNVDLHDDLELDPVSK---YLQ 238 + L ++L + P K YLQ Sbjct: 246 DSPSKPLFEELNIVPFDKRIIYLQ 269 >SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) Length = 552 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 409 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 468 Query: 176 FQRNVDLHDDLELDPVSK---YLQ 238 + L ++L + P K YLQ Sbjct: 469 DAPSKPLFEELNIVPFDKRIIYLQ 492 >SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 109 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 168 Query: 176 FQRNVDLHDDLELDPVSK---YLQ 238 + L ++L + P K YLQ Sbjct: 169 DAPSKPLFEELNIVPFDKGIIYLQ 192 >SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 172 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 131 Query: 176 FQRNVDLHDDLELDPVSK---YLQ 238 + L ++L + P K YLQ Sbjct: 132 DAPSKPLFEELNIVPFDKRITYLQ 155 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 5/84 (5%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 207 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 266 Query: 176 FQRNVDLHDDLELDPVSK---YLQ 238 + L ++L + P K YLQ Sbjct: 267 DAPSKPLFEELNIVPFDKRIIYLQ 290 >SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 4/83 (4%) Frame = +2 Query: 2 LCRRSK-LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWF 178 L R+ K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 63 LKRKKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKWD 122 Query: 179 QRNVDLHDDLELDPVSK---YLQ 238 + L ++L + P K YLQ Sbjct: 123 APSKPLFEELNIVPFDKRIIYLQ 145 >SB_9149| Best HMM Match : Lipase_GDSL (HMM E-Value=0.51) Length = 604 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 5/84 (5%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q + R+ + W Sbjct: 436 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKQCARVIIDKKW 495 Query: 176 FQRNVDLHDDLELDPVSK---YLQ 238 L ++L + P K YLQ Sbjct: 496 DAPAKPLFEELNIVPFDKRIIYLQ 519 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 37.5 bits (83), Expect = 0.010 Identities = 21/84 (25%), Positives = 43/84 (51%), Gaps = 5/84 (5%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + + R R+ + W Sbjct: 204 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGLTKKQHIDYMVKFEKRCARVILDKKW 263 Query: 176 FQRNVDLHDDLELDPVSK---YLQ 238 + L ++L + P K YLQ Sbjct: 264 DAPSKPLFEELNIVPFDKRIIYLQ 287 >SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 169 Score = 36.7 bits (81), Expect = 0.017 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 5/84 (5%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R+ + W Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKGCARVILDKKW 131 Query: 176 FQRNVDLHDDLELDPVSK---YLQ 238 + L ++L + P K YLQ Sbjct: 132 NAPSKPLLEELNIVPFDKRIIYLQ 155 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 36.7 bits (81), Expect = 0.017 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLK-PLQVIQSRFCRIA 160 L +R+++ + + + Y TC+RP++ Y + +F H +K L+ IQ R IA Sbjct: 626 LLKRARVPVSDIIGFYNTCVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIA 679 >SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) Length = 439 Score = 35.1 bits (77), Expect = 0.051 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +2 Query: 44 LYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 LY T + P +TY+ V + + T LKPL ++Q R RI Sbjct: 282 LYYTLLFPFLTYSVVTWGNTYATTLKPLFILQKRAIRI 319 >SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 228 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 160 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 219 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 34.7 bits (76), Expect = 0.068 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KPLQVIQSRFCRI 157 +R+ + ++ + Y TCIRPV YA VF H L L+ Q R RI Sbjct: 1213 KRANIKVKELLLFYLTCIRPVTEYACPVFHHCLPQYLSNDLERCQKRALRI 1263 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 34.7 bits (76), Expect = 0.068 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 605 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 664 >SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) Length = 277 Score = 34.3 bits (75), Expect = 0.090 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 207 LLKRTKKFLSLKARTLFYHALIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 266 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 34.3 bits (75), Expect = 0.090 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 823 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDNKW 882 >SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 34.3 bits (75), Expect = 0.090 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KPLQVIQSRFCRI 157 +R+ L Y TCIRP+M YA VF ++ L + L++I+ R RI Sbjct: 331 KRASLGSEELHQFYLTCIRPIMEYACPVFHNSLPDYLSQDLEIIRRRALRI 381 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 33.5 bits (73), Expect = 0.16 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 +R +S + V +Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 698 KRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANSLEAIQKRALRI 747 >SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) Length = 172 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 +R +S N + +Y++ +R + YASVVFA R L+ +Q R Sbjct: 15 KRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 60 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 +R +S N + +Y++ +R + YASVVFA R L+ +Q R Sbjct: 397 KRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 442 >SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KPLQVIQSRFCRI 157 +RS L+ V+ ++TC+RP+ YA V+ + + L L+ +Q R RI Sbjct: 276 KRSGLAKSGLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRALRI 326 >SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) Length = 599 Score = 33.1 bits (72), Expect = 0.21 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAP 172 +R +S N + +Y++ +R + YASVVFA R L+ +Q C +A+ P Sbjct: 463 KRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQK--CTLAIIYP 515 >SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) Length = 151 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 +R +S N + +Y++ +R + YASVVFA R L+ +Q R Sbjct: 15 KRCGVSTDNIIVVYRSLVRSTLKYASVVFADLPRYLSDSLERVQKR 60 >SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/61 (22%), Positives = 30/61 (49%) Frame = +2 Query: 47 YKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRNVDLHDDLELDPVS 226 + I+P+M Y V+ + + ++Q R RI W+ ++ L ++L ++P + Sbjct: 3 FNALIQPLMDYCITVWGDNLIEHDNTILLLQKRAARIIAYKKWYDHSMALFEELNIEPFT 62 Query: 227 K 229 K Sbjct: 63 K 63 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS VFA+ L+ +Q R +IA Sbjct: 62 ITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) Length = 172 Score = 32.7 bits (71), Expect = 0.27 Identities = 18/70 (25%), Positives = 35/70 (50%) Frame = +2 Query: 11 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRNV 190 RS L L ++ + I+PVM YA+V+++ + + + Q R R + A ++ Sbjct: 35 RSYLPLNQRINHFNAIIKPVMNYANVIWSTCDKESQYRILKFQKRAARTILYAGRLTPSI 94 Query: 191 DLHDDLELDP 220 +L + L+ P Sbjct: 95 ELFNRLQWLP 104 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQ 181 KL++ K+T+Y+ CI + Y S + AR K L R R +G W + Sbjct: 474 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHWLR 527 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS VFA+ L+ +Q R +IA Sbjct: 62 ITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 32.7 bits (71), Expect = 0.27 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 +R +S + V +Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 416 KRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 465 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 32.7 bits (71), Expect = 0.27 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 +R +S + V +Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 351 KRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 400 >SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) Length = 587 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 ++ L + +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 74 KKCGLDAKELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 124 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 177 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 228 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 13 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 64 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 563 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 614 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 13 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 64 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 525 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 576 >SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 32.3 bits (70), Expect = 0.36 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLK-PLQVIQSR 145 RR+++ ++ + Y + IRPV+ Y + VF HA + L ++ +Q R Sbjct: 477 RRARVPTKDIIDFYCSAIRPVLEYCAAVFHHALPSYLSDDIERVQKR 523 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 94 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 145 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 93 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 144 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 94 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILGIHW 145 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 13 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 64 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 314 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 365 >SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 92 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 13 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 64 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 13 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 64 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 2405 KLTISTKITVYRACILSTLLYGSEPWTTYARQE-KRLNTFHMRCLRRILGIHW 2456 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 94 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILGIHW 145 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 146 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 197 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 129 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 180 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 94 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 145 >SB_34392| Best HMM Match : Ank (HMM E-Value=5.2e-12) Length = 382 Score = 32.3 bits (70), Expect = 0.36 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +2 Query: 107 RTNLKPLQVIQSRFCRIAVGAPWFQRNVDLHDDLELDPVSKYLQSASLRPLRRRHDMRT 283 R K L++ + + G Q+N +L +L LDPV K L S + P RH + T Sbjct: 18 RPTEKKLEMYEGQITSTTTGMESQQKN-NLAAELPLDPVMKVLDSLRIEPRATRHALNT 75 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 13 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 64 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 243 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 294 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 129 KLTISTKITVYRACILSTLLYGSKSWTTYARQE-KRLNTFHMRCLRRILGIHW 180 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 203 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 254 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 146 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 197 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 13 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 64 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/39 (33%), Positives = 26/39 (66%) Frame = +2 Query: 41 TLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 +LY + +RP + YAS V+A A T+++ ++ +Q R ++ Sbjct: 858 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 896 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ C+ + Y S + AR K L R R +G W Sbjct: 485 KLTISTKITVYRACVLSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 536 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/39 (33%), Positives = 26/39 (66%) Frame = +2 Query: 41 TLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 +LY + +RP + YAS V+A A T+++ ++ +Q R ++ Sbjct: 449 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 487 >SB_4451| Best HMM Match : Cornifin (HMM E-Value=0.11) Length = 1384 Score = 31.9 bits (69), Expect = 0.48 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = +3 Query: 264 GGTT*EPSCRGRRKLHTRSCRPFGKPSTSPKARHHGSS*SINGAFRQYKHRSPSSPNPSL 443 GG+ +P C R + H S KP + RHHG S S ++KH S P Sbjct: 641 GGSDSKPYCGNRFRHHGGS---HSKPYCGNRFRHHGGSHSKPYCGNRFKHHGGSHSKPYC 697 Query: 444 ATK 452 T+ Sbjct: 698 GTR 700 Score = 31.5 bits (68), Expect = 0.63 Identities = 19/58 (32%), Positives = 26/58 (44%) Frame = +3 Query: 264 GGTT*EPSCRGRRKLHTRSCRPFGKPSTSPKARHHGSS*SINGAFRQYKHRSPSSPNP 437 GG+ +P C R K H S KP + +HHG S S + ++KH S P Sbjct: 753 GGSHSKPYCGNRFKHHGGS---HSKPYCGNRFKHHGGSDSKSYCGNRFKHHGGSDSKP 807 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = +3 Query: 264 GGTT*EPSCRGRRKLHTRSCRPFGKPSTSPKARHHGSS*SINGAFRQYKHRSPSSPNPSL 443 GG+ +P C R + H S KP + +HHG S S ++KH S P Sbjct: 657 GGSHSKPYCGNRFRHHGGS---HSKPYCGNRFKHHGGSHSKPYCGTRFKHHGGSDSKPYC 713 Query: 444 ATK 452 T+ Sbjct: 714 GTR 716 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +3 Query: 264 GGTT*EPSCRGRRKLHTRSCRPFGKPSTSPKARHHGSS*SINGAFRQYKHRSPSSPNP 437 GG+ +P C R K H S KP + +HHG S S ++KH S P Sbjct: 721 GGSDSKPYCGNRFKHHGGSD---SKPYCGNRFKHHGGSHSKPYCGNRFKHHGGSHSKP 775 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +3 Query: 264 GGTT*EPSCRGRRKLHTRSCRPFGKPSTSPKARHHGSS*SINGAFRQYKHRSPSSPNP 437 GG+ +P C R K H S KP + RHHG S S +++H S P Sbjct: 609 GGSHSKPYCGNRFKHHGGSD---SKPYCGNRFRHHGGSDSKPYCGNRFRHHGGSHSKP 663 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +3 Query: 264 GGTT*EPSCRGRRKLHTRSCRPFGKPSTSPKARHHGSS*SINGAFRQYKHRSPSSPNP 437 GG+ +P C R K H S KP + +HHG S S ++KH S P Sbjct: 689 GGSHSKPYCGTRFKHHGGSD---SKPYCGTRFKHHGGSDSKPYCGNRFKHHGGSDSKP 743 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/58 (32%), Positives = 25/58 (43%) Frame = +3 Query: 264 GGTT*EPSCRGRRKLHTRSCRPFGKPSTSPKARHHGSS*SINGAFRQYKHRSPSSPNP 437 GG+ +P C R K H S KP + +HHG S S ++KH S P Sbjct: 705 GGSDSKPYCGTRFKHHGGSD---SKPYCGNRFKHHGGSDSKPYCGNRFKHHGGSHSKP 759 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 31.9 bits (69), Expect = 0.48 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R R +G W Sbjct: 94 KLTISTKITVYRACILNTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHW 145 >SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) Length = 237 Score = 31.9 bits (69), Expect = 0.48 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 3/91 (3%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRN---VDLHDD 205 K YKT + P + YAS + + ++K ++ +Q R R W + ++ +D Sbjct: 115 KEAAYKTLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNC-WDRTPGTVTNILND 173 Query: 206 LELDPVSKYLQSASLRPLRRRHDMRTLLSWP 298 LE P+SK Q A L + + ++ L P Sbjct: 174 LEWPPLSKRRQDARLTLFYKAVNKKSALEIP 204 >SB_39284| Best HMM Match : WW (HMM E-Value=7.9) Length = 251 Score = 31.9 bits (69), Expect = 0.48 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 127 ITVYRSLIRSVIEYASAAFANLPNYLFDALENVQRRALKIA 167 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 31.9 bits (69), Expect = 0.48 Identities = 13/39 (33%), Positives = 26/39 (66%) Frame = +2 Query: 41 TLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 +LY + +RP + YAS V+A A T+++ ++ +Q R ++ Sbjct: 392 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 430 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 31.9 bits (69), Expect = 0.48 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRNVDL 196 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA ++ ++ L Sbjct: 981 ITVYRSLIRSVIEYASAAFANLPNYLSNALENVQRRALKIAFPGSSYEGSLTL 1033 >SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) Length = 679 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/50 (30%), Positives = 30/50 (60%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 ++S LS N + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 545 KKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 594 >SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) Length = 754 Score = 31.5 bits (68), Expect = 0.63 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGA 169 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA A Sbjct: 575 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAFPA 618 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 31.5 bits (68), Expect = 0.63 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR-FCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R CRI +G W Sbjct: 317 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLCRI-LGIHW 368 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 31.5 bits (68), Expect = 0.63 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLK-PLQVIQSRFCRIA 160 L +R+ + + + + Y TC+RP++ Y + + HA LK L+ IQ IA Sbjct: 277 LLKRTIVPVSDIIGFYDTCVRPILEYCAPLSYHAIPAYLKEDLEHIQKSALSIA 330 >SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 31.5 bits (68), Expect = 0.63 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRNVDL 196 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA ++ ++ L Sbjct: 59 ITVYRSLIRSVIEYASAAFANLPNYLSDALEDVQRRALKIAFPGSSYEGSLTL 111 >SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) Length = 208 Score = 31.5 bits (68), Expect = 0.63 Identities = 17/63 (26%), Positives = 33/63 (52%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRN 187 ++ L + +T+Y++ IR V+ YAS FA+ L+ +Q R +IA ++ + Sbjct: 74 KKCGLDVIELITVYRSLIRSVIEYASEAFANLPNYLSDALEKVQRRALKIAFPGSSYEGS 133 Query: 188 VDL 196 + L Sbjct: 134 LTL 136 >SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 179 ITVYRSFIRSVIEYASAAFANLPNCLCDDLENVQRRALKIA 219 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 31.5 bits (68), Expect = 0.63 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 3/91 (3%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRN---VDLHDD 205 K YK+ + P + YAS + + ++K ++ +Q R R W + ++ +D Sbjct: 142 KEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVTNC-WDRTPGTVTNILND 200 Query: 206 LELDPVSKYLQSASLRPLRRRHDMRTLLSWP 298 LE P+SK Q+A L + + ++ L P Sbjct: 201 LEWPPLSKRRQNARLTLFYKAVNKKSALEIP 231 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 31.5 bits (68), Expect = 0.63 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR-FCRIAVGAPW 175 KL++ K+T+Y+ CI + Y S + AR K L R CRI +G W Sbjct: 197 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLCRI-LGIHW 248 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 ++ + + + VT+Y + IRP+ YASV+F++ + L+ IQ R Sbjct: 4157 KKCGVPVEDMVTVYCSLIRPITEYASVIFSNIPCYLSEALEKIQRR 4202 >SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 352 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/54 (25%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ Sbjct: 294 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 347 >SB_38574| Best HMM Match : WW (HMM E-Value=4.9) Length = 256 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS+ FA+ L+ +Q R +IA Sbjct: 132 ITVYRSPIRSVIEYASIAFANLQNYLSDVLENVQRRVLKIA 172 >SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) Length = 596 Score = 31.5 bits (68), Expect = 0.63 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGA 169 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA A Sbjct: 444 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAFPA 487 >SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) Length = 397 Score = 31.5 bits (68), Expect = 0.63 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRNVDL 196 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA ++ ++ L Sbjct: 273 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAFPGSSYEGSLTL 325 >SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) Length = 310 Score = 31.5 bits (68), Expect = 0.63 Identities = 15/50 (30%), Positives = 30/50 (60%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 ++S LS N + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 176 KKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 225 >SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 322 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 187 LLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 316 LLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 367 >SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) Length = 283 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 187 LLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+K +++IQ R R Sbjct: 573 KDSAYRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 612 >SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) Length = 499 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 407 LLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 458 >SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 149 LLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 200 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 31.1 bits (67), Expect = 0.84 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KPLQVIQSRFCRI 157 +RS L V+ ++TC+RP+ YA V+ + + L L+ +Q R RI Sbjct: 670 KRSGLGKSVLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRGLRI 720 >SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 99 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 139 >SB_5514| Best HMM Match : TB (HMM E-Value=4.3) Length = 243 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 62 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 102 >SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 213 ITVYRSLIRSVIEYASATFANLPNYLSDALENVQRRTLKIA 253 >SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 371 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 187 LLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_54439| Best HMM Match : SNF (HMM E-Value=0) Length = 701 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 658 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 698 >SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) Length = 523 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 388 LLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 439 >SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 199 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 239 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.1 bits (67), Expect = 0.84 Identities = 21/90 (23%), Positives = 44/90 (48%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRN 187 ++ + +++ VT+Y + IR + YASV+F + + L+ IQ R +I + +Q Sbjct: 2755 KKCGVPVKDMVTVYCSLIRSITEYASVIFPNIPCYLSEALEKIQRRALKIIIPGCQYQDA 2814 Query: 188 VDLHDDLELDPVSKYLQSASLRPLRRRHDM 277 + L L+ A ++ L R++ + Sbjct: 2815 LRLSGLQTLEDRRHLACEAFMKNLNRQNPL 2844 >SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) Length = 284 Score = 31.1 bits (67), Expect = 0.84 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 L +++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 149 LLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 200 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 31.1 bits (67), Expect = 0.84 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 3/91 (3%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRN---VDLHDD 205 K YK+ + P + YAS + + ++K ++ +Q R R W + ++ +D Sbjct: 548 KEAAYKSLVHPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNC-WDRTPGTVTNILND 606 Query: 206 LELDPVSKYLQSASLRPLRRRHDMRTLLSWP 298 LE P+SK Q A L + + ++ L P Sbjct: 607 LEWPPLSKRRQDARLTLFYKAVNKKSALKIP 637 >SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.1 bits (67), Expect = 0.84 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 32 NKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 +++T Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 118 HRITDYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 162 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+K +++IQ R R Sbjct: 201 KDSAYRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 240 >SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) Length = 595 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 480 ITVYRSLIRSVIEYASAAFANFPNYLSDALENVQRRALKIA 520 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 118 RVKVTAYTAIVRPMLEYASAAWDPHLKKDIASLEKVQRKAARFC 161 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 3/91 (3%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRN---VDLHDD 205 K YK+ + P + YAS + + ++K ++ +Q R R W + ++ +D Sbjct: 813 KEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRSGRFVKNC-WDRTPGTVTNILND 871 Query: 206 LELDPVSKYLQSASLRPLRRRHDMRTLLSWP 298 LE P+SK Q A L + + ++ L P Sbjct: 872 LEWPPLSKRRQDARLTLFYKAVNKKSALKIP 902 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/40 (35%), Positives = 25/40 (62%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 V +Y + IR ++ YA+VVF++ + + L+ +Q R RI Sbjct: 132 VAVYCSLIRSILEYATVVFSNLPKYLSEALEKVQKRSLRI 171 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 909 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 952 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 14 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 57 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 215 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 258 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 201 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 244 >SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 124 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 124 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 447 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 490 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 631 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 674 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 733 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 776 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R Sbjct: 176 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 228 >SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 2 LCRRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 L +R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 124 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 421 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 464 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 664 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 707 >SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +2 Query: 2 LCRRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 L ++ LS K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 162 LTKQIVLSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 216 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 K + Y+T +RP + YA++ + + N+ +++IQ R I Sbjct: 175 KDSAYRTLVRPKLEYATIAWNPYTQCNINKIEMIQRRAASI 215 >SB_31424| Best HMM Match : Sigma54_activat (HMM E-Value=6.2) Length = 263 Score = 30.3 bits (65), Expect = 1.5 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 3/91 (3%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRN---VDLHDD 205 K YK+ + P + YAS + + ++K ++ +Q R R W + ++ +D Sbjct: 135 KEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNC-WDRTPGTVTNILND 193 Query: 206 LELDPVSKYLQSASLRPLRRRHDMRTLLSWP 298 LE P+SK Q A L + + ++ L P Sbjct: 194 LEWPPLSKRRQDARLTLFYKAVNKKSALEIP 224 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 623 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 666 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 506 RVKVTAYTAIVRPMLEYASAAWDPYLQKDIASLEKVQRKAARFC 549 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 29 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFC 151 R KVT Y +RP++ YAS + + ++ L+ +Q +RFC Sbjct: 439 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 482 >SB_3365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 248 LRPLRRRHDMRTLLSWPPETTYPI 319 LRP+R+ + +R L WPP +Y I Sbjct: 66 LRPIRQSYTIRRALPWPPTQSYTI 89 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +3 Query: 357 ARHHGSS*SINGAFRQYKHRSPSSPNPSLATKGSTSELTHRHSPLSFSPDLS 512 A+H G S + FR R+PS P PS T +S +H SP+ S Sbjct: 128 AKHTGKDGSPDKTFRD---RTPSPPKPSARTSAPSSPSPTKHPTWEASPEKS 176 >SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) Length = 479 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIA 160 +T+Y++ IR V+ Y+S FA+ L+ +Q R +IA Sbjct: 382 ITVYRSLIRSVIEYSSAAFANLPNYLSDALENVQRRALKIA 422 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQ 181 ++ + + + VT+Y + IR V YASV+F++ + L+ IQ R +I + +Q Sbjct: 781 KKCGVPVEDMVTVYCSLIRSVTEYASVIFSNIPCYLSEVLEKIQRRALKIIMPGCQYQ 838 >SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 +R +S + + +Y++ +R + YASVVFA R L +Q R Sbjct: 15 KRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYPSDSLVRVQKR 60 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGA-PWFQRNVDLHDDLE 211 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 436 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 495 Query: 212 LDPVSKYLQSASL 250 LD + Q A L Sbjct: 496 LDSLEVRRQLAQL 508 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 +R +S + + +Y++ +R + YASVVFA R L +Q R Sbjct: 623 KRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 668 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +2 Query: 11 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPW 175 R+ + K+ LYK+ + P +TY + + ++ + L+ +Q R R AV W Sbjct: 341 RNLIPTNAKLVLYKSAVLPYLTYCHLTWHFCKASDSRKLERLQERALR-AVFKDW 394 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 ++S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 1027 KKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 1076 >SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 559 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 ++S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 425 KKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 474 >SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) Length = 427 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 ++S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 293 KKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 342 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 +R +S + + +Y++ +R + YASVVFA R L +Q R Sbjct: 139 KRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 184 >SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTNLKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L ++ + Y I+P+ +YA V+ A+ + +L +Q R R+ + A +V L Sbjct: 153 LPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDSLSKFLTLQKRAARLILNAEPRAPSVPL 212 Query: 197 HDDLELDP 220 + L+ P Sbjct: 213 FNRLQWLP 220 >SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) Length = 652 Score = 29.5 bits (63), Expect = 2.6 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR-IAVGAPWFQRNVD- 193 LSLR + +Y +C+R M YA +A + ++L LQ + R I V P ++ Sbjct: 558 LSLRTRGKVYSSCVRSAMLYAGECWAPKS-SDLARLQRSEHAMLRWICVLKPEDDTSLST 616 Query: 194 LHDDLELDPVSKYLQSASLR 253 + D L ++ + L+ A LR Sbjct: 617 IRDRLGIESLELALRKARLR 636 >SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) Length = 409 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 ++S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 301 KKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 350 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 ++S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 594 KKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 643 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +2 Query: 11 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 R+ + + K+ LYK+ I P +TY V+ + + L+ +Q R R Sbjct: 756 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 803 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +2 Query: 11 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 R+ + + K+ LYK+ I P +TY V+ + + L+ +Q R R Sbjct: 385 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 432 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) Length = 537 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 223 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 262 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 175 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 214 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 815 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 854 >SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 91 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 150 Query: 197 HDDLELDP 220 + L+ P Sbjct: 151 FNKLQWLP 158 >SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 179 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 113 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 152 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 703 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 742 >SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) Length = 252 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 208 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 247 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +2 Query: 11 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 R+ + + K+ LYK+ I P +TY V+ + + L+ +Q R R Sbjct: 385 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 432 >SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 94 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 883 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 922 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 V +Y + IR ++ YASVVF++ + + L+ +Q R Sbjct: 639 VAVYCSLIRSILEYASVVFSNLPKYLSEALEKVQKR 674 >SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRI 157 +++Y I+P Y S V+ + +++ LQV+Q+R R+ Sbjct: 222 ISIYNALIKPHFGYCSEVWDTLGQGHVRRLQVLQNRAARV 261 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 673 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 712 >SB_13834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 86 VVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRNVDLHDD 205 ++ R +L+P + +RF A W R +DL DD Sbjct: 24 IILLGKLRESLRPAESTANRFTEDECEAQWLSRGLDLQDD 63 >SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 94 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KPLQVIQSRFCRI 157 +R+ + + + Y TCIRP YA +F ++ L L+ Q R RI Sbjct: 676 KRAHVKPKELILFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRVLRI 726 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 755 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 798 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) Length = 449 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 159 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 202 >SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 654 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +3 Query: 405 YKHR-SPSSPNPSLATKGSTSELTHRHSP-LSFSPDLSV 515 + HR SPSSP+PS + H H P LS SP ++ Sbjct: 604 HHHRHSPSSPSPSCIAIITVIHYRHNHHPALSSSPSFTI 642 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 35 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 78 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 121 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 164 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KPLQVIQSRFCRI 157 +R+ + + + Y TCIRP YA +F ++ L L+ Q R RI Sbjct: 669 KRAHVKPKELILFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRALRI 719 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 418 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 477 Query: 197 HDDLELDP 220 + L+ P Sbjct: 478 FNRLQWLP 485 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +2 Query: 47 YKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFCR 154 YKT +RP + YAS V++ + ++ +Q +RFC+ Sbjct: 516 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 554 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +2 Query: 47 YKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFCR 154 YKT +RP + YAS V++ + ++ +Q +RFC+ Sbjct: 98 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 136 >SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 93 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 152 Query: 197 HDDLELDP 220 + L+ P Sbjct: 153 FNRLQWLP 160 >SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L ++ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 212 LPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEHRAPSVPL 271 Query: 197 HDDLELDP 220 + L+ P Sbjct: 272 FNRLQWLP 279 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 300 RKLHTRSCRPFGKPSTSPKARHHGSS 377 R HTR R G+P+T P HH S Sbjct: 499 RYAHTRPTRTVGRPATLPPQSHHHRS 524 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 1462 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 1505 >SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 201 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 260 Query: 197 HDDLELDP 220 + L+ P Sbjct: 261 FNRLQWLP 268 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1415 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 212 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 271 Query: 197 HDDLELDP 220 + L+ P Sbjct: 272 FNRLQWLP 279 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 446 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 489 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +2 Query: 47 YKTCIRPVMTYASVVFAHAARTNLKPLQVIQ---SRFCR 154 YKT +RP + YAS V++ + ++ +Q +RFC+ Sbjct: 584 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 622 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_25475| Best HMM Match : DUF1279 (HMM E-Value=0.63) Length = 239 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = -1 Query: 184 PLEPWSSDGYPAESGLYNLKGFQVGAGRVSEHYACIRHDGAYASFVEGYLITE 26 P + ++ DG G+ NL+GF++ G V+E A I+ + ++G + T+ Sbjct: 37 PQQLFNEDG-SVRGGVANLRGFKLAMGSVAEVDAVIQENTERVQELQGVVATD 88 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 674 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 717 >SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) Length = 132 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 38 VTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 + +Y++ +R + YASVVFA R L+ +Q R Sbjct: 6 LVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 41 >SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) Length = 244 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVG 166 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 141 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 184 >SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 128 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 187 Query: 197 HDDLELDP 220 + L+ P Sbjct: 188 FNRLQWLP 195 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 28.7 bits (61), Expect = 4.5 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 715 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 774 Query: 197 HDDLELDP 220 + L+ P Sbjct: 775 FNRLQWLP 782 >SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 898 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 +RS ++ + +Y IRP+M YA VFA + L+ +Q R Sbjct: 695 KRSGVADSEIIQVYCCLIRPIMEYACAVFADLPQYLSHALERVQKR 740 >SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) Length = 798 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAAR 109 +R +S + + +Y++ +R + YASVVFA R Sbjct: 739 KRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPR 772 >SB_4128| Best HMM Match : Luteo_Vpg (HMM E-Value=1.7) Length = 211 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +2 Query: 209 ELDPVSKYLQSASLRPLRRRHDMRTLLSWPPETTYPIL-*TVW 334 +++ S ++ ++ RPL+RRH + L S+ P+ + I TVW Sbjct: 163 KIERTSSLVERSTKRPLQRRHTISDLNSFSPQASPSIAKRTVW 205 >SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 88 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLTRFLTLQKRAARLILNAEPRAPSVPL 147 Query: 197 HDDLELDP 220 + L+ P Sbjct: 148 FNRLQWLP 155 >SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) Length = 654 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 148 ESGLYNLKGFQVGAGRVSEHYACIRHD 68 E+ +LKG+ +GA VS H+ C D Sbjct: 249 ETLFQSLKGYLIGAQEVSRHFKCFLSD 275 >SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 379 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSR 145 +R S + + +Y++ +R + YASVVFA L+ IQ R Sbjct: 243 KRCGASTDDIIVVYRSLVRSTLEYASVVFADLPGYLSDSLERIQKR 288 >SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 32 NKVTLYKTCIRPVMTYASVVFAHAARTNLK 121 N+ YK CIR + YA VF +A LK Sbjct: 646 NRTLFYKACIRSAVDYAVPVFHNALPQYLK 675 >SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) Length = 319 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L ++ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 194 LPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 253 Query: 197 HDDLELDP 220 + L+ P Sbjct: 254 FNRLQWLP 261 >SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) Length = 952 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 8 RRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQ 181 +RS ++ + +Y IRP+M YA VFA + L+ +Q R I +Q Sbjct: 816 KRSGVADSEIMQVYCRLIRPIMEYACTVFADLPQYLSHALERVQKRTLSIVFPGTSYQ 873 >SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) Length = 238 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGA 169 L L+ + Y I+P+ +YA V+ A+ + L +Q R R+ + A Sbjct: 153 LPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNA 203 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 17 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCR 154 KL++ K+T+Y+ CI + Y S + AR K L R R Sbjct: 607 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLR 651 >SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 7.8 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 508 RSGEKLSGLCLWVNSLVE 455 R+G + G+CLWV S++E Sbjct: 12 RNGSSVPGMCLWVVSIIE 29 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 3/91 (3%) Frame = +2 Query: 35 KVTLYKTCIRPVMTYASVVFAHAARTNLKPLQVIQSRFCRIAVGAPWFQRN---VDLHDD 205 K YK+ + P + YAS + + ++K ++ +Q R W + ++ +D Sbjct: 251 KEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGSFVKNC-WDRTPGTVTNILND 309 Query: 206 LELDPVSKYLQSASLRPLRRRHDMRTLLSWP 298 LE P+SK Q A L + + ++ L P Sbjct: 310 LEWPPLSKRRQDARLTLFYKAVNKKSALKIP 340 >SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 20 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKPLQVIQSRFCRIAVGAPWFQRNVDL 196 L ++ + Y I+P+ +YA V+ A+ + L +Q R R+ + A +V L Sbjct: 93 LPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQKRAARLILNAEPRAPSVPL 152 Query: 197 HDDLELDP 220 + L+ P Sbjct: 153 FNRLQWLP 160 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,935,512 Number of Sequences: 59808 Number of extensions: 457171 Number of successful extensions: 1638 Number of sequences better than 10.0: 199 Number of HSP's better than 10.0 without gapping: 1482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1629 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -