BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00760 (664 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 3.4 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 3.4 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 170 PWFQRNVDLHDDLELDPVSKYLQSASLRPLRRRHDMRTLL 289 P F RN+D +++ +LD + ++LR L ++++ L Sbjct: 365 PKFPRNIDEYNNNDLDTKKWNNKISALRALNDLYNVKNTL 404 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 477 RHSPLSFSPDLSVGRASDPVVDSAKLLLLG 566 +H P+ P S G ASD +D A LG Sbjct: 462 QHWPMEEEPAASWGSASDVTLDEAVKSPLG 491 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,887 Number of Sequences: 438 Number of extensions: 3885 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -