BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00758 (793 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 3.3 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 5.7 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 21 9.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.9 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 522 KPMEDTIYADEDQDLSTLE 578 +P+ + IY+ D D STLE Sbjct: 1328 RPLSEHIYSSIDSDYSTLE 1346 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 395 ITRTSNANSSPMIVAVTVTTQA 330 ++RTS A P VA TVT+ + Sbjct: 720 VSRTSTAGQFPTNVATTVTSMS 741 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.2 bits (45), Expect = 5.7 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -3 Query: 629 LQGIVVRFILVFFLIGSF*GAQILVFVSVYSILHRFEVVEGLLLYFWLSNF 477 + G++V F + F L+ GAQ + V + IL+ + ++ W S F Sbjct: 240 VMGMIV-FCITFGLVAGQFGAQGKLIVDFFMILNEIIMKLVGIIIMWYSPF 289 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/20 (30%), Positives = 15/20 (75%) Frame = +3 Query: 633 LHDITVLEEDNIGDDEDMLD 692 ++++ +EE+NI D +++D Sbjct: 30 IYELRQIEEENIEPDTELMD 49 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +2 Query: 185 HALIPDPITMYTQKETMK 238 HAL+ DP+ + ++ T++ Sbjct: 177 HALLKDPVKEFWERRTLQ 194 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.9 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +2 Query: 185 HALIPDPITMYTQKETMK 238 HAL+ DP+ + ++ T++ Sbjct: 230 HALLKDPVKEFWERRTLQ 247 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,668 Number of Sequences: 438 Number of extensions: 4299 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -