BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00755 (777 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 25 0.60 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 25 0.79 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 24 1.8 AY078400-1|AAL83703.1| 31|Apis mellifera major royal jelly pro... 24 1.8 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 9.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.7 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 25.4 bits (53), Expect = 0.60 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 212 FNQEPSTKCCKY*GFKIVAVDLQAMAALPGVKQIQGDITK 331 + E S CC+ G + +V L A PG K+ + ITK Sbjct: 69 WQMERSCMCCQESGEREASVSLFCPRAKPGEKKFRKVITK 108 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 25.0 bits (52), Expect = 0.79 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 137 LICKSLNALRARQPSSLASL*YISRLSLDVLPIF 36 L+ + + AL R LAS +I LSL + P+F Sbjct: 2 LVARPMQALSIRHAVILASFVWIYALSLSLPPLF 35 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 429 ISCKPVTSGAPSHTTKSA 376 I+C+ VTS A +H KSA Sbjct: 13 IACQDVTSAAVNHQRKSA 30 >AY078400-1|AAL83703.1| 31|Apis mellifera major royal jelly protein MRJP3 protein. Length = 31 Score = 23.8 bits (49), Expect = 1.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 429 ISCKPVTSGAPSHTTKSA 376 I+C+ VTS A +H KSA Sbjct: 13 IACQDVTSAAVNHQRKSA 30 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -3 Query: 412 YIWRTITYNQICFEALELFYYSICCFLFGNIPLNL 308 Y W TI Y EA + + N+PL L Sbjct: 158 YAWSTIDYTYDSIEARDSAIFDGDFITENNLPLGL 192 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = +2 Query: 404 PDVTGLHDIDEYVQSQLLLAALNITTHVLKNE 499 P++ +D Y+ L+ A N T H ++N+ Sbjct: 357 PEIRVFNDGSLYLTKVQLIHAGNYTCHAVRNQ 388 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,930 Number of Sequences: 438 Number of extensions: 4814 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -