BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00754 (832 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 28 0.40 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 8.6 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 27.9 bits (59), Expect = 0.40 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 343 FFCHSRSTWVRY**CCQTIL*PDSLV*LFIASDLMGSGS 227 FF S+W R QT+L + + FIA+D+ G+GS Sbjct: 288 FFTTEESSWFRETEIYQTVLMRNENILGFIAADIKGTGS 326 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 8.6 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 705 SCHGYVQPVLREPANDEGGLQREREAIESEFAIASPSDSNR 827 SCH Y V +E ND+ +E+ +I SE + S S+ R Sbjct: 485 SCHSYELFVGQEKGNDDN--NKEKMSIRSE-GLESVSEITR 522 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 832,490 Number of Sequences: 2352 Number of extensions: 16598 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 87651612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -