BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00750 (564 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9666| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 >SB_9666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 65.7 bits (153), Expect = 2e-11 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = +2 Query: 77 MALTFAAGNKVFYDKQVVKQIDVPSFSGAFGILPKHVPTLAVLRPGVVTILE 232 M+LTFA+ + FY V Q+DV + SG+FGILP HVPTL V++PGV+T+ E Sbjct: 35 MSLTFASPTEGFYRDAAVTQVDVSTTSGSFGILPSHVPTLQVIKPGVLTVYE 86 Score = 62.5 bits (145), Expect = 2e-10 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +1 Query: 256 FVSSGTITVNDDSSVQVLAEEAHPLESIDRSAAQEALSKAQSEFNSASN 402 FVSSG +TVN DS+VQ+LAEEAHPL+ D AA + L +AQ E + AS+ Sbjct: 94 FVSSGAVTVNADSTVQILAEEAHPLDRFDVQAANKQLEEAQQELSGASS 142 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,951,975 Number of Sequences: 59808 Number of extensions: 245232 Number of successful extensions: 551 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -