BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00742 (722 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 4.4 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.6 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/48 (20%), Positives = 23/48 (47%) Frame = +1 Query: 10 YHFIRN*HLIAYSSVLIHLFTSFYNYIKMQCHL*LESLVYKVLTMKRE 153 Y+ ++ ++ Y+ L + F Y+K++ +Y++LT E Sbjct: 171 YYILQITLIVNYALALKNRFKELQKYLKIETSCRYVGTLYRILTTMME 218 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +2 Query: 2 FFFTISFVINT*LPTRVCSFIYSPVFIIILKCNVICDLNL*FI 130 + F +F+I T C+FI+ + ++ L C L+L F+ Sbjct: 167 YHFFCAFIIFTMHLLFCCAFIFFNMHLLFLLCLDYFTLHLLFL 209 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,001 Number of Sequences: 336 Number of extensions: 3350 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -