BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00740 (755 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 2.5 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 7.7 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.0 bits (52), Expect = 2.5 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +3 Query: 627 LILLEEETQFYINIYFDFWTS*SLYFNFTRIW 722 L+LL ET + +Y+DF+ + +F+ ++ Sbjct: 749 LLLLRNETDYKFYVYYDFYGKDNPHFHVPSLY 780 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.4 bits (48), Expect = 7.7 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = +3 Query: 603 IET*IHHFLILLEEETQFYINIYFDFWTS*SLYFNFTRIWYNFSYYF 743 + T + +LI + + IY S + +F F +W +S YF Sbjct: 126 LPTELGEYLISVNRRVDRFSKIYCCCHFSMATFFWFMPVWTTYSAYF 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,037 Number of Sequences: 2352 Number of extensions: 10371 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -