BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00739 (705 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC56F2.03 |||actin-like protein Arp10 |Schizosaccharomyces pom... 25 8.0 SPAC869.05c |||sulfate transporter |Schizosaccharomyces pombe|ch... 25 8.0 >SPBC56F2.03 |||actin-like protein Arp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 380 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -3 Query: 406 LCIPITNIIGQDLFVKMITTIKIIRWKFIVLSPLGFIFHF 287 +C P+T I+ +I I + KFIV+ L + H+ Sbjct: 101 ICAPLTAILSTSTRDAIIVDIGMKETKFIVILDLCILMHY 140 >SPAC869.05c |||sulfate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 840 Score = 25.4 bits (53), Expect = 8.0 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = +2 Query: 524 FGCLYQFILMFIGYICNYISVQICMYWFMVFL*RC--DVVVFLVGLSL 661 FG + FIL F Y+C Y+ + + FL VV +VG ++ Sbjct: 287 FGLVSLFILFFTKYMCQYLGKRYPRWQQAFFLTNTLRSAVVVIVGTAI 334 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,735,163 Number of Sequences: 5004 Number of extensions: 56667 Number of successful extensions: 109 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -