BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00739 (705 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47740.1 68416.m05201 ABC transporter family protein ATP bind... 29 3.0 >At3g47740.1 68416.m05201 ABC transporter family protein ATP binding cassette transporter ABC1, Homo sapiens, PIR2:A54774 Length = 947 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -2 Query: 287 LANNSLSTTFR*LMTNF*TK*IISKKNYFNIEAK 186 LANN L+TTF+ TN+ I+S + +NI+ + Sbjct: 168 LANNVLATTFKGSATNYLDAGIVSDGSIYNIQPR 201 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,991,815 Number of Sequences: 28952 Number of extensions: 246739 Number of successful extensions: 371 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -