BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00738 (738 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0315 - 2347254-2347345,2347485-2347895,2348182-2349633,234... 35 0.078 >11_01_0315 - 2347254-2347345,2347485-2347895,2348182-2349633, 2349688-2350045,2350818-2351177,2351321-2351419, 2351856-2351948,2352078-2352215,2352389-2352476, 2352682-2352770,2353113-2353178,2353370-2353481, 2354702-2354901 Length = 1185 Score = 34.7 bits (76), Expect = 0.078 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +1 Query: 247 LRRDTREFDKYFNHGAESAMDQHQQYRYEQQCYRPVYCPEQAPEP 381 L RD + F H E A+D +Y + QCY V+C QA +P Sbjct: 109 LSRDAKARKLAFQHWIE-AIDPRHRYGHNLQCYYDVWCQSQAGQP 152 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,911,351 Number of Sequences: 37544 Number of extensions: 348820 Number of successful extensions: 1053 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1053 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -