BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00738 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 25 1.8 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 2.4 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 25 3.2 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 24 5.6 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 9.8 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 250 RRDTREFDKYFNHGAESAMDQHQQYRYEQQ 339 RR+ E DK N +SA H Q + +Q+ Sbjct: 208 RREREEQDKMKNESLKSAQQHHSQKQAQQE 237 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.0 bits (52), Expect = 2.4 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 Query: 403 TSSRYSIPVPALVPDSKPADSIVARICTAGVDP 305 T Y++P +VP + + A +C GV P Sbjct: 481 TCEDYALPYQDVVPSDPSFEDMYAVVCVKGVRP 513 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 265 EFDKYFNHGAESAMDQHQQYRYEQQCYRPVYCPEQAP 375 EF K + G S + + +YE+ C+ + PE P Sbjct: 644 EFLKQHDIGRASFIALEKIQQYERNCHTQIQTPENVP 680 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 23.8 bits (49), Expect = 5.6 Identities = 15/63 (23%), Positives = 25/63 (39%) Frame = +1 Query: 175 TSAESSTGGRIHESSFRNKDGISRLRRDTREFDKYFNHGAESAMDQHQQYRYEQQCYRPV 354 T+ T RIH + D + +R F +++ H + ++CYR Sbjct: 305 TTCGRKTDLRIHVQNLHTADKPIKCKRCDSTFPDRYSY------KMHAKTHEGEKCYRCE 358 Query: 355 YCP 363 YCP Sbjct: 359 YCP 361 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 318 AVQIRATMLSAGLLSGTSAGTGILY 392 AV + ML AG+ + +S TG+LY Sbjct: 315 AVIMSLDMLIAGIDTTSSGSTGVLY 339 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 689,236 Number of Sequences: 2352 Number of extensions: 12309 Number of successful extensions: 41 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -