BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00736 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 27 0.46 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 1.4 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 25 1.8 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 23 9.8 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 27.5 bits (58), Expect = 0.46 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +1 Query: 172 FYEQWGEIVDVVVMKDPKTKRSKGFGFIHILKPIWLMKLKIIGLTKLTEELSSQNEQF 345 ++ + G V VVV DP+T R + + I +PI M+ K LT +E + E F Sbjct: 1703 YHNRMGRPVQVVVYDDPRTVRVREIIYDEIDRPI--MQTKWTKLTSHLKEYFAFYENF 1758 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 542 HNHQTLQNQSPFLSCFFICHNTNRNNISK 456 H+HQ + NQ L CF C N + K Sbjct: 426 HHHQQVHNQQRILYCF--CRNVECKELEK 452 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 25.4 bits (53), Expect = 1.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 716 IDQNDSNLRGFPPDPRVDRDLIYHYPRQTCQFSILLFSHPNVD 588 I++N +L GFP P++DR + P Q + H VD Sbjct: 10 IEKNLLSLFGFPNRPKIDRSKVV-IPEAMKQLYAQIMGHDLVD 51 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 285 AQNNRPHKIDGRIVEPKRAVPREEIKRPEA 374 AQ P G+ +PK+ + + +PEA Sbjct: 143 AQRETPKSSGGQSKQPKKKKKKRSLPKPEA 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,043 Number of Sequences: 2352 Number of extensions: 12396 Number of successful extensions: 44 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -