BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00734 (740 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20890.1 68414.m02616 expressed protein Location of ESTs OAO2... 29 4.3 At2g04910.1 68415.m00511 glycosyl hydrolase family protein 17 si... 28 7.5 >At1g20890.1 68414.m02616 expressed protein Location of ESTs OAO242 5' end, gb|Z30466 and OAO242 3' end, gb|Z30467 Length = 197 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 92 RPYLIYNINYNEFQFRIPH-IWRIYKFSVLCFCKIKIILYSLGSSFIL 232 RP +IYNI E IPH W + VLC + +IL S++L Sbjct: 143 RPSIIYNIVCEEQLLGIPHSSWSVVVLVVLCLV-VALILPRFLPSYLL 189 >At2g04910.1 68415.m00511 glycosyl hydrolase family protein 17 similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 124 Score = 27.9 bits (59), Expect = 7.5 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -1 Query: 662 NLWSSAQNTPTHFNIELQYNTFCYSYITKKNNLNI 558 N S+A T T + +L N FCYSY++ N N+ Sbjct: 80 NFNSTAFITQTDPSKQLYLNPFCYSYLSSLINQNL 114 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,600,733 Number of Sequences: 28952 Number of extensions: 319924 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -