BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00733 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 53 7e-09 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 2.9 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 8.8 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 8.8 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 53.2 bits (122), Expect = 7e-09 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 4/91 (4%) Frame = +2 Query: 245 RRGRNGTIDFPEFLTMMA--RKMKDTDSEEEIREDFRVFDKDGNGFISAAELRHVMTNLG 418 +RG I F EFL + + +K K+ E+ E +++DK+ +G + AEL H +T LG Sbjct: 57 KRGEK-KIKFEEFLPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALG 115 Query: 419 EKLTDEEVDEMIREA--DIDGDGQVNYEEFV 505 E+L D E+D ++++ D DG + Y F+ Sbjct: 116 ERLDDVELDNVMKDCMDPEDDDGNIPYAPFL 146 Score = 37.9 bits (84), Expect = 3e-04 Identities = 16/45 (35%), Positives = 28/45 (62%) Frame = +3 Query: 78 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPT 212 MA+ L + +I + + FS++D +G G + +LG +R+L NPT Sbjct: 1 MANDLKDVEIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPT 45 Score = 33.1 bits (72), Expect = 0.008 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +3 Query: 111 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE 242 +F E L+DK+ DGT+ EL + +LG+ + EL +++ + Sbjct: 86 DFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKD 129 Score = 30.3 bits (65), Expect = 0.058 Identities = 20/71 (28%), Positives = 38/71 (53%) Frame = +2 Query: 293 MARKMKDTDSEEEIREDFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID 472 MA +KD + E+ + F V+D +G+G + A +L + + L T E + +M Sbjct: 1 MANDLKDVEIEKA-QFVFSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKM-GGTQKR 58 Query: 473 GDGQVNYEEFV 505 G+ ++ +EEF+ Sbjct: 59 GEKKIKFEEFL 69 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.6 bits (51), Expect = 2.9 Identities = 21/100 (21%), Positives = 42/100 (42%) Frame = +2 Query: 188 EVARTEPHRSRTSRHDQ*SRRGRNGTIDFPEFLTMMARKMKDTDSEEEIREDFRVFDKDG 367 EVA T + R R E+L + ++K + E+E +++ +DK Sbjct: 161 EVAGTRVYDERKEESMNLLRESEGKLEKISEYLRTIEDRLKTLEEEKEELSEYQKWDK-- 218 Query: 368 NGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQV 487 + L +V+ K T ++++E+ + GD Q+ Sbjct: 219 ----ARRTLEYVIYETELKETRKQLEELDGQRKSSGDKQL 254 Score = 23.4 bits (48), Expect = 6.7 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 356 DKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQ 484 D++GN E T +G +++ +VD +RE + GQ Sbjct: 1061 DQEGNDMEREVETSDEFTGIGIRVSFTQVDAEMREMNQLSGGQ 1103 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 Query: 542 CVKSREFKYTFCFMTHNISIVLDLHFSS 625 C + Y F T NIS + + H+SS Sbjct: 3093 CYEQHGLSYVFPHNTSNISGITEDHYSS 3120 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.0 bits (47), Expect = 8.8 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 103 RSPSLRRHSHCSTKTAMAPSRPKS 174 RSP RR S + T+ SRP S Sbjct: 272 RSPPARRRSRSTRPTSWPRSRPTS 295 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,789 Number of Sequences: 2352 Number of extensions: 10629 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -