BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00731 (661 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein... 30 1.6 At2g30290.1 68415.m03687 vacuolar sorting receptor, putative sim... 30 1.6 At1g30900.1 68414.m03780 vacuolar sorting receptor, putative sim... 30 1.6 At4g21550.1 68417.m03113 transcriptional factor B3 family protei... 29 3.6 At2g14720.2 68415.m01657 vacuolar sorting receptor, putative ide... 29 3.6 At2g14720.1 68415.m01656 vacuolar sorting receptor, putative ide... 29 3.6 At1g62530.1 68414.m07055 hypothetical protein 28 4.8 At4g15475.1 68417.m02365 F-box family protein (FBL4) 99.7% ident... 28 6.3 At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol p... 28 6.3 At3g18215.1 68416.m02317 expressed protein contains Pfam profile... 28 6.3 At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nea... 28 6.3 At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nea... 28 6.3 At1g75560.1 68414.m08781 zinc knuckle (CCHC-type) family protein... 28 6.3 At1g21240.1 68414.m02654 wall-associated kinase, putative simila... 28 6.3 >At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein contains PF01422: NF-X1 type zinc finger Length = 912 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 2/74 (2%) Frame = +3 Query: 282 SCINSKCDTPCNADICQEPAQCKVHLHQAHCACPPGFTNTGKECRKTEGPQC--ISDIDC 455 +C + + PC + Q+P +C+ H C G +C P C + D + Sbjct: 463 ACGETHFEVPCGTETNQKPPRCRKLCHITP-LCRHGQNQKPHKCHYGACPPCRLLCDEEY 521 Query: 456 PSGTGCLNYRCVNP 497 P G C RC P Sbjct: 522 PCGHKC-KLRCHGP 534 >At2g30290.1 68415.m03687 vacuolar sorting receptor, putative similar to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737218 Length = 625 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 360 HQAHCACPPGFTNTG-KECRKTEGPQCISDIDCPSGTGCLNYRCVN 494 H C CPPGF G KEC+ +C C C + +C N Sbjct: 496 HSKGCKCPPGFIGDGLKECKDVN--ECEEKTACQ----CRDCKCKN 535 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 572 CECLPGYKGNALQECKPYQTVAKCIERS 655 C+C PG+ G+ L+ECK V +C E++ Sbjct: 500 CKCPPGFIGDGLKECK---DVNECEEKT 524 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +1 Query: 7 CACRQGFIGDASSGCYEI-QCQSDSHC-ADDETCINRRCVPACSVNAN 144 C C GFIGD C ++ +C+ + C D C N CS + + Sbjct: 500 CKCPPGFIGDGLKECKDVNECEEKTACQCRDCKCKNTWGSYECSCSGS 547 >At1g30900.1 68414.m03780 vacuolar sorting receptor, putative similar to BP-80 vacuolar sorting receptor [Pisum sativum] GI:1737222 Length = 631 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +3 Query: 354 HLHQAHCACPPGFTNTGKECRKTEGPQCISDIDCPSGTGCLN 479 +L + C CPPGF G +C + + S C G C N Sbjct: 492 NLETSGCRCPPGFKGDGLKCEDIDECKEQSACQC-DGCNCKN 532 >At4g21550.1 68417.m03113 transcriptional factor B3 family protein low similarity to SP|Q01593 Abscisic acid-insensitive protein 3 {Arabidopsis thaliana}, SP|P37398 Viviparous protein homolog {Oryza sativa}; contains Pfam profile PF02362: B3 DNA binding domain Length = 721 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +3 Query: 399 TGKECRKTEGPQCISDIDCPSGTGCLNYRCVNPCLVSTHVVKMRSARL 542 T K R +G CI I PSG G + RC + + T+ + RS L Sbjct: 557 TTKHPRHRDGCTCIICIQSPSGIGPKHDRCCSCAVCDTNKRRRRSLLL 604 >At2g14720.2 68415.m01657 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 28.7 bits (61), Expect = 3.6 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = +2 Query: 572 CECLPGYKGNALQECK 619 CEC PG+KG+ +++C+ Sbjct: 501 CECPPGFKGDGVKKCE 516 >At2g14720.1 68415.m01656 vacuolar sorting receptor, putative identical to GB:U79960 GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 28.7 bits (61), Expect = 3.6 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = +2 Query: 572 CECLPGYKGNALQECK 619 CEC PG+KG+ +++C+ Sbjct: 501 CECPPGFKGDGVKKCE 516 >At1g62530.1 68414.m07055 hypothetical protein Length = 282 Score = 28.3 bits (60), Expect = 4.8 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 7/88 (7%) Frame = +3 Query: 183 SCILSL*DRYSWKPIYSLHSHWLQT--DTDCP-SDKSCI----NSKCDTPCNADICQEPA 341 SC+L L +++P+ H L + DC S SC NS+ + + ++ Q A Sbjct: 87 SCLLDLNKPPAYEPVSIDHQCGLDGVHEKDCSASPASCCTAENNSRTEGEDSCEVIQMAA 146 Query: 342 QCKVHLHQAHCACPPGFTNTGKECRKTE 425 +C VH+ G G+ C E Sbjct: 147 ECLVHISAVSHNQSHGVQEPGRSCDSFE 174 >At4g15475.1 68417.m02365 F-box family protein (FBL4) 99.7% identical to F-box protein family, AtFBL4 (GP:21536497) [Arabidopsis thaliana]; similar to grr1 GI:2407790 from [Glycine max] Length = 610 Score = 27.9 bits (59), Expect = 6.3 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 3/101 (2%) Frame = +1 Query: 43 SGCYEIQCQSDSHCADDETCINRRCVPACSVNANTCGQSA---ECYGLEHRASCRCKIGT 213 S CY + C+ A + R + C N T G A C L+ A C+ Sbjct: 328 SDCYFVSCKGLEAIAHGCKELERVEINGCH-NIGTRGIEAIGKSCPRLKELALLYCQ--R 384 Query: 214 VGNPSIACTPIGCRLTQIVHLINHVSIPNVIRPAMQIFARN 336 +GN ++ GC+ +I+HL++ I ++ ++ RN Sbjct: 385 IGNSALQEIGKGCKSLEILHLVDCSGIGDIAMCSIAKGCRN 425 >At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol protease, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 452 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +1 Query: 7 CACRQGFIGDASS-GCYEIQCQSDSHCADDETCINRRCVPACSVNANTC 150 C C + G S GC + + C DD + + P C + ANTC Sbjct: 375 CCCLYEYNGKCYSWGCCPYESAT---CCDDGSSCCPQSYPVCDLKANTC 420 >At3g18215.1 68416.m02317 expressed protein contains Pfam profile PF04654: Protein of unknown function, DUF599 Length = 244 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -2 Query: 339 LVPGKYLHCRAYHIWN*YMIYQMDNLCQSAANGSASYRWV 220 LVP + AYH+W Y I L A N + +WV Sbjct: 11 LVPTGLVVMVAYHVWLVYAILHRPKLTVIALNAESRRQWV 50 >At2g14740.2 68415.m01663 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 27.9 bits (59), Expect = 6.3 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = +1 Query: 7 CACRQGFIGDASSGCYEIQCQSDSHCADDETCINRRCVPACSVNANTCGQSAEC 168 C C GF GD + C +I + C + + C +C P CS NT G S EC Sbjct: 501 CECPPGFKGDGTKKCEDI-----NECKEKKAC---QC-PECSCK-NTWG-SYEC 543 Score = 27.9 bits (59), Expect = 6.3 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 572 CECLPGYKGNALQECK 619 CEC PG+KG+ ++C+ Sbjct: 501 CECPPGFKGDGTKKCE 516 >At2g14740.1 68415.m01662 vacuolar sorting receptor, putative nearly identical to vacuolar sorting receptor homolog [Arabidopsis thaliana] GI:1737220; contains a calcium-binding EGF-like domain signature Length = 628 Score = 27.9 bits (59), Expect = 6.3 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = +1 Query: 7 CACRQGFIGDASSGCYEIQCQSDSHCADDETCINRRCVPACSVNANTCGQSAEC 168 C C GF GD + C +I + C + + C +C P CS NT G S EC Sbjct: 501 CECPPGFKGDGTKKCEDI-----NECKEKKAC---QC-PECSCK-NTWG-SYEC 543 Score = 27.9 bits (59), Expect = 6.3 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 572 CECLPGYKGNALQECK 619 CEC PG+KG+ ++C+ Sbjct: 501 CECPPGFKGDGTKKCE 516 >At1g75560.1 68414.m08781 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 257 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 264 DCPSDKSCINSKCDTPCNADICQEPAQCKVHLHQAHCA--CPPGFTN 398 DC +DK+C N + D C+ C + H A CP G +N Sbjct: 152 DCTNDKACKNCRTSGHIARD-CRNDPVCNICSISGHVARHCPKGDSN 197 >At1g21240.1 68414.m02654 wall-associated kinase, putative similar to wall-associated kinase 1 [Arabidopsis thaliana] GI:3549626; expressed in leaves and stems & induced by salicylic acid or INA (PMID:10380805) Length = 741 Score = 27.9 bits (59), Expect = 6.3 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 106 NRRCVPACSVNANTCGQSAECYGLEHRAS--CRCKIGTVGNP 225 N+ C A S CG+++ CY R C+C G GNP Sbjct: 246 NQTCEQAGSTRI--CGKNSSCYNSTTRNGYICKCNEGYDGNP 285 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,272,526 Number of Sequences: 28952 Number of extensions: 383240 Number of successful extensions: 981 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 981 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -