BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00730 (730 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0515 + 10121849-10122149,10132151-10132187,10132314-101327... 29 5.0 02_05_0746 - 31451303-31453168,31453243-31453357,31454296-314543... 28 6.6 02_02_0365 + 9488328-9488583,9489343-9489495,9491159-9491451,949... 28 8.7 >09_02_0515 + 10121849-10122149,10132151-10132187,10132314-10132790, 10133184-10133733 Length = 454 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 300 GESEICSISYEKPTNVLQRTYKDLSDVTPFLSNT 401 GES+I I+Y +NVL T DL T + NT Sbjct: 22 GESKIVRINYINTSNVLAVTLGDLKTSTSLILNT 55 >02_05_0746 - 31451303-31453168,31453243-31453357,31454296-31454351, 31455057-31455138,31455484-31455517,31455912-31456016, 31456108-31456387 Length = 845 Score = 28.3 bits (60), Expect = 6.6 Identities = 20/66 (30%), Positives = 30/66 (45%) Frame = +1 Query: 22 SSAVIGKLP*RSTSAVIFLSRPKGLIYQVIKSLKKINKTRPKQLWKIEKVPVEYTFKLSL 201 SS+V GKL R+ S++ P G + + L + KTRP+ + V L+L Sbjct: 209 SSSVTGKLKSRAESSLKTYHVPIGYLKTIEDILSSVTKTRPQWTRLVSAVDHRVDRSLAL 268 Query: 202 FWEMAI 219 AI Sbjct: 269 LRPQAI 274 >02_02_0365 + 9488328-9488583,9489343-9489495,9491159-9491451, 9491538-9492105,9492503-9493011 Length = 592 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +1 Query: 91 GLIYQVIKSLKKINKTRPKQLWKIEKVPVEYTFK 192 G + Q+I+S KK+N P+QL+ ++ V +F+ Sbjct: 377 GSLGQIIQSRKKLNGHNPQQLFSMDNVDSSDSFQ 410 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,438,636 Number of Sequences: 37544 Number of extensions: 300086 Number of successful extensions: 560 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -