BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00729 (718 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 28 0.066 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 28 0.066 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 1.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 24 1.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 1.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 1.4 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 1.9 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 5.7 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 7.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 28.3 bits (60), Expect = 0.066 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = +2 Query: 2 FLKMASVATVTRALLGKNVLNKCKVVSATSQASIKFYSTASYENIKVE 145 FLK+ ++ TV +LG V++K + TSQ IK T +Y N K++ Sbjct: 59 FLKVVTIITVFFVVLGAAVVSKGTTLFMTSQ--IKKNVTRAYCNKKID 104 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 28.3 bits (60), Expect = 0.066 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = +2 Query: 2 FLKMASVATVTRALLGKNVLNKCKVVSATSQASIKFYSTASYENIKVE 145 FLK+ ++ TV +LG V++K + TSQ IK T +Y N K++ Sbjct: 59 FLKVVTIITVFFVVLGAAVVSKGTTLFMTSQ--IKKNVTRAYCNKKID 104 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.8 bits (49), Expect = 1.4 Identities = 19/84 (22%), Positives = 38/84 (45%), Gaps = 3/84 (3%) Frame = +2 Query: 458 AGNAVRYHLCRRKGEIRQPEINIGTIPGAGGTQ--RLPRYVGKSKAMEIVLTGNFFDAHE 631 +G ++Y + E +GT+ GAGGT + V S + IV G F + Sbjct: 265 SGQVMKYAALATENFSSLLEPAVGTMTGAGGTAIVSISTSVSTSVYLAIVFNGLFTEEDV 324 Query: 632 AE-KMGLVSKVFPVEKLLEETIKL 700 A+ + + + + +L+E +++ Sbjct: 325 ADVPINVTLSLDEKKYILQEVVRV 348 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.8 bits (49), Expect = 1.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 474 RTALPAHNHPQE 439 RT LP H HPQ+ Sbjct: 374 RTNLPTHRHPQD 385 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.8 bits (49), Expect = 1.4 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -2 Query: 714 PILSASLMVSSKSFSTGNTLLTRPIFS-AS*ASKKFPVNTISIAFDLPTYLGRRWVPPAP 538 PILS + + S+ T + P S P++T S+ D + +PP P Sbjct: 175 PILSPEMSQVAASWHTPSMYPLSPGAGFRSPYPSALPISTSSLPSDFYRFSPTGLIPPHP 234 Query: 537 GMVP 526 G+ P Sbjct: 235 GLSP 238 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.8 bits (49), Expect = 1.4 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -2 Query: 714 PILSASLMVSSKSFSTGNTLLTRPIFS-AS*ASKKFPVNTISIAFDLPTYLGRRWVPPAP 538 PILS + + S+ T + P S P++T S+ D + +PP P Sbjct: 67 PILSPEMSQVAASWHTPSMYPLSPGAGFRSPYPSALPISTSSLPSDFYRFSPTGLIPPHP 126 Query: 537 GMVP 526 G+ P Sbjct: 127 GLSP 130 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 395 LQLWETHHCRC*WFRSWGWL*AGN 466 L++ HHCR + S GW AG+ Sbjct: 69 LEMTLAHHCRFKFSSSVGWSPAGH 92 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 523 HWHHPRSRRHPASSQIRWQVESNG 594 HWH S+ P SQ Q+ NG Sbjct: 273 HWHLTDSQSFPLVSQRVPQLAKNG 296 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.4 bits (43), Expect = 7.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 498 AKFGNPRSTLAPSPEPEAPSVFPDTLASRK 587 A + S +PS PE SV P +L R+ Sbjct: 207 ASTASSASNYSPSQSPEPESVRPLSLVVRR 236 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,944 Number of Sequences: 336 Number of extensions: 4111 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -