BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00726 (747 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 3.3 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 24 4.3 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 4.3 EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. 24 5.7 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.6 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.6 bits (51), Expect = 3.3 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 539 GNQEGSILIHQEDWLQPSCCRFRAHFWMARRQHVGAFNQN 658 G Q + I + WLQ + RA RR+H +F+ N Sbjct: 982 GRQFSNEGISGQSWLQLQQQKLRARREQQRREHSNSFSYN 1021 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 24.2 bits (50), Expect = 4.3 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 157 EKFEKEAQEMGKGSFKYAWVLDKLKAERDWYHNDIALW 270 E F+K Q + Y W K ERD +N +A W Sbjct: 127 EWFKKSVQRVSGYEDYYVWQDPKPGTERDPPNNWVAAW 164 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 4.3 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 593 SWVVANLLDV*GYFLLDFLKSGLTV-WWF 510 ++V+AN L V FLL K L + WWF Sbjct: 927 AFVMANALFVLVIFLLQLKKQELHIEWWF 955 >EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. Length = 421 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 321 VSRSINDGNIVLASFELPESNIVVIPVTLSL 229 VSRS D N+ F +SN+V P ++ L Sbjct: 39 VSRSDFDWNLAREVFRHEDSNVVFSPFSIKL 69 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.6 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 513 PPYSEPRFEEIKKEVSSYIKKIGYNPAAVAF 605 PP+S +KK+ Y+++ N +A F Sbjct: 333 PPWSNRTLRNLKKDRMKYLRRYRLNRSAFNF 363 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 825,387 Number of Sequences: 2352 Number of extensions: 17905 Number of successful extensions: 43 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -