BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00722 (771 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35800| Best HMM Match : 7tm_1 (HMM E-Value=3e-05) 29 3.1 SB_34135| Best HMM Match : rve (HMM E-Value=3e-29) 28 9.6 >SB_35800| Best HMM Match : 7tm_1 (HMM E-Value=3e-05) Length = 301 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 Query: 181 SKLTNCIISPSSTHVFKYHFVAVKAKSAMC 92 +KLTN ++ SS H YH+ A + A C Sbjct: 256 AKLTNSPLTDSSRHCLHYHYAATECFPACC 285 >SB_34135| Best HMM Match : rve (HMM E-Value=3e-29) Length = 324 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -2 Query: 161 HIPFIHSCLQISFRGCQSKICYVQKLYL*STSK--NIFV*NCEFLYQMKPIDKY 6 H+ F H +++ RG Q ++Q + T K N+FV C++ + KPI ++ Sbjct: 97 HLSFAHQ--RVAHRGRQKTEKWIQDNFAEVTQKVINVFVQLCKYHAEQKPITRH 148 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,067,546 Number of Sequences: 59808 Number of extensions: 339717 Number of successful extensions: 538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -