BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00722 (771 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44480.1 68416.m04781 disease resistance protein (TIR-NBS-LRR... 29 2.6 At3g10790.1 68416.m01299 F-box family protein contains F-box dom... 29 3.4 >At3g44480.1 68416.m04781 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1194 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = -2 Query: 203 RVFFARFLKINKLYHIPFIHSCLQISFRGCQSKICYVQK 87 R++F + K+N+ +H+C+ F G Q C++ + Sbjct: 1013 RLYFPKCFKLNQEARDLIMHTCIDAMFPGTQVPACFIHR 1051 >At3g10790.1 68416.m01299 F-box family protein contains F-box domain Pfam:PF00646 Length = 319 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 184 KRAKKTRVTCTLSSYITPSSHAIFKNSL 267 K+ K + CT++ Y+TP + IF N + Sbjct: 210 KQKKWRMIECTINHYLTPGTQGIFSNGV 237 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,623,609 Number of Sequences: 28952 Number of extensions: 247046 Number of successful extensions: 457 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -