BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00721 (726 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7RF80 Cluster: Predicted protein; n=1; Nematostella ve... 36 1.3 UniRef50_Q12XY8 Cluster: Putative uncharacterized protein; n=1; ... 34 3.1 UniRef50_A0CCG5 Cluster: Chromosome undetermined scaffold_167, w... 33 9.5 >UniRef50_A7RF80 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1477 Score = 35.5 bits (78), Expect = 1.3 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = +2 Query: 302 PVVDSANTALASANVSNAARLEPRELTYTIRLCWHSLCHQLR*GKKVTVIEPAI 463 P DS + L N N ARL + +Y R CWH + + GK VT I+ I Sbjct: 290 PSSDSPSVRLPRVNTMNEARLLSKRTSYECRKCWHLMEEK---GKMVTSIKATI 340 >UniRef50_Q12XY8 Cluster: Putative uncharacterized protein; n=1; Methanococcoides burtonii DSM 6242|Rep: Putative uncharacterized protein - Methanococcoides burtonii (strain DSM 6242) Length = 517 Score = 34.3 bits (75), Expect = 3.1 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = -3 Query: 187 SCSNIIAAKLLIVYLNTVQQLLYSPAILSIYFIIVASI*CLAGHIANDLS 38 S + II LLI++L T+ L Y P L ++ + +ASI G+I N L+ Sbjct: 287 SFNEIIFLSLLILFLPTIYSLTYGPYFLVLFIVFLASI--SFGNILNSLA 334 >UniRef50_A0CCG5 Cluster: Chromosome undetermined scaffold_167, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_167, whole genome shotgun sequence - Paramecium tetraurelia Length = 2472 Score = 32.7 bits (71), Expect = 9.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 80 CNYNEIY*QYRRAIQQLLHCVEIYNQQ 160 C Y+E++ Q ++ I L C E+YNQQ Sbjct: 1626 CQYDELFNQCKKIIDTLTDCSELYNQQ 1652 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 625,185,496 Number of Sequences: 1657284 Number of extensions: 11271188 Number of successful extensions: 21166 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21159 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 59090914597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -