BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00721 (726 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0838 + 11641484-11642030,11643614-11643650,11643784-116438... 30 1.6 06_01_0065 + 549972-550770,551577-552190,552392-552544,552769-55... 29 5.0 >03_02_0838 + 11641484-11642030,11643614-11643650,11643784-11643841, 11646176-11646265,11646796-11646913,11648093-11648277, 11648330-11648455,11648578-11648634,11648741-11648821, 11649068-11649102,11649265-11649354,11649443-11649599, 11649785-11649901 Length = 565 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 277 LLTGSRFRSGGRFCEHGSC 333 LL G+ FR G++CEH C Sbjct: 169 LLVGNSFRGSGKYCEHAVC 187 >06_01_0065 + 549972-550770,551577-552190,552392-552544,552769-552885, 552972-553076,553269-553334,553430-553494,553577-553778, 554026-554169,554212-554340 Length = 797 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/32 (37%), Positives = 22/32 (68%), Gaps = 2/32 (6%) Frame = +2 Query: 110 RRAIQQLLHCVEIYNQQL--GGYNIGARSCQK 199 RR + QL+ C++ Y+QQ+ G ++G+ S +K Sbjct: 309 RRIVTQLMTCMDEYHQQIGSGSGDVGSESAEK 340 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,653,451 Number of Sequences: 37544 Number of extensions: 307876 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -