BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00714 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 62 4e-10 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 50 1e-06 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 44 9e-05 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 44 2e-04 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 41 0.001 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.006 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.010 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 37 0.013 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.054 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 34 0.094 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.12 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 33 0.16 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 32 0.50 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 32 0.50 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 31 0.87 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 30 1.5 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 30 2.0 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 2.7 SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) 29 3.5 SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) 29 3.5 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_25359| Best HMM Match : p450 (HMM E-Value=0) 29 4.7 SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 4.7 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 28 6.2 SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) 28 6.2 SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 28 6.2 SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) 28 6.2 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 28 6.2 SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 28 6.2 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 28 6.2 SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) 28 6.2 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 28 8.1 SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) 28 8.1 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 28 8.1 SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) 28 8.1 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 62.1 bits (144), Expect = 4e-10 Identities = 30/87 (34%), Positives = 50/87 (57%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F E++ V DP T RSRGF F+ FK P+++D V+ +G ++ Sbjct: 128 FEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKMVTTTK---- 183 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTI 502 KIF+GGLS+ S+++++ +FS+FG + Sbjct: 184 -KIFIGGLSTNTSEEDMKKYFSQFGKV 209 Score = 29.1 bits (62), Expect = 3.5 Identities = 9/26 (34%), Positives = 20/26 (76%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAYVK 260 +K+F+GGLS T++++++ +F + K Sbjct: 183 KKIFIGGLSTNTSEEDMKKYFSQFGK 208 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/45 (44%), Positives = 32/45 (71%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 + + N+R+GFCF++F+SE V+ + +T I G +V+VKRA PK Sbjct: 138 EHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPK 182 Score = 50.0 bits (114), Expect = 2e-06 Identities = 29/78 (37%), Positives = 39/78 (50%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRHGKIFV 436 E+ +++K D TGR RGFAF+ FK D + I R KIFV Sbjct: 54 ELVGVDIKMDALTGRPRGFAFVQFKHQSEADAIDPKPAAPIGK------PPHLRVKKIFV 107 Query: 437 GGLSSEISDDEIRNFFSE 490 GGL E SD++IR +F + Sbjct: 108 GGLKPETSDEKIREYFGK 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = +3 Query: 132 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G S D N DD KLFVGGLS+ETT + L+++F Y Sbjct: 12 GTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYFSKY 52 Score = 34.7 bits (76), Expect = 0.071 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTIL 505 GK+FVGGLS E + + ++ +FS++G ++ Sbjct: 29 GKLFVGGLSYETTKESLKEYFSKYGELV 56 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFG 248 +K+FVGGL ET+D+++R++FG Sbjct: 103 KKIFVGGLKPETSDEKIREYFG 124 Score = 32.7 bits (71), Expect = 0.29 Identities = 15/43 (34%), Positives = 26/43 (60%) Frame = +2 Query: 251 IREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 379 ++EIE I T+ ++ R RGF F+ F + +++DK+ H I Sbjct: 130 VKEIEYI---TEHSSNRRRGFCFVSFDSEDTVDKICETQFHNI 169 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 50.0 bits (114), Expect = 2e-06 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 5/98 (5%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F EI+ VK DPNT RSRGF F+ FK E V++ H I + Sbjct: 135 FTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST-SHRIQGRLCEVRLPRPKE 193 Query: 422 -----GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCP 520 K+FVG L ++ + +F++FG + + P Sbjct: 194 ELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIP 231 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 FDK + +GF F+TFESE + T I K+V+VK+A PK Sbjct: 4 FDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINN 385 D T R RGF F+ F++ S DK H INN Sbjct: 5 DKATQRHRGFGFVTFESENSADKACDTQYHLINN 38 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/62 (35%), Positives = 36/62 (58%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 681 L ++M D+ N+ KG+CF+ F +E +V+ L + GK+V++K+A G GG G Sbjct: 133 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKAADL--GAGGRG 190 Query: 682 TR 687 R Sbjct: 191 GR 192 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 12/85 (14%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAAGE-HTINNXXXXXXXXXXRHG-- 424 ++ S+++ P G+SR F F+ F + ID ++ E H+I+N R Sbjct: 38 DVSSVSLAKTPE-GKSRKFCFVEFSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDDPN 96 Query: 425 --------KIFVGGLSSEISDDEIR 475 K+F+GGL E S+++++ Sbjct: 97 ELAHVRTKKLFIGGLKDEHSEEDVK 121 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/29 (44%), Positives = 22/29 (75%), Gaps = 2/29 (6%) Frame = +3 Query: 174 DDDR--KLFVGGLSWETTDKELRDHFGAY 254 DD + KLFVGGL+ +TT++ +R +F ++ Sbjct: 3 DDSKLMKLFVGGLNEDTTEETVRAYFKSF 31 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEF 493 K+FVGGL+ + +++ +R +F F Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSF 31 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/85 (28%), Positives = 42/85 (49%) Frame = +2 Query: 293 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRHGKIFVGGLSSEISDDEI 472 +G+S+GFAF+ + E+++ V+ +H I+N + K+ + + S I + +I Sbjct: 79 SGKSKGFAFVRLRKKEAVESVLGRDDHVIDN-SDVSMEKQDTYRKVILKNIPSSIGESQI 137 Query: 473 RNFFSEFGTILEWRCPLTKQRTKER 547 FS G I P +TKER Sbjct: 138 LEHFSSSGEIASVYIP-ENLKTKER 161 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 526 KTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEV 633 KTK +RKG C +TF S +++K K I G ++ Sbjct: 157 KTK-ERKGHCIVTFASVTEAFEVVKKRKHHIHGYDI 191 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 11/75 (14%) Frame = +2 Query: 296 GRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH-----------GKIFVGG 442 GRSRGF F+ +++ +S+++V+ +H +++ R KIFVGG Sbjct: 86 GRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGG 145 Query: 443 LSSEISDDEIRNFFS 487 L+S +++I+ +F+ Sbjct: 146 LASTTVEEDIKEYFN 160 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +1 Query: 526 KTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 K + +GF F+T+ES VN++LK + +E++ KR+ P+ + Sbjct: 83 KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDE 128 Score = 36.7 bits (81), Expect = 0.018 Identities = 12/24 (50%), Positives = 20/24 (83%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 RK+F+GGL+W TT++ L+D+F + Sbjct: 50 RKIFIGGLNWNTTEEGLKDYFSQW 73 Score = 35.1 bits (77), Expect = 0.054 Identities = 14/41 (34%), Positives = 30/41 (73%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 KIF+GGL+ +++ ++++FS++GTI++ C + K+ + R Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWGTIVD--CVIMKRDGRSR 89 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 257 EIESINVKTD-PNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 379 E+ +++K D N R RGFAF+ F E ++KV A H I Sbjct: 170 EVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEI 211 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/51 (27%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +1 Query: 508 MEMPFDKTKNQR-KGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +++ D+ +R +GF F+TF+++++V + I K+ +VK+A P+ Sbjct: 174 VDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 224 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/23 (39%), Positives = 19/23 (82%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGA 251 RK+FVGGL+ T +++++++F + Sbjct: 139 RKIFVGGLASTTVEEDIKEYFNS 161 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = +3 Query: 150 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 N E D KLFVGGL+ ETT++ LR++F AY Sbjct: 3 NRQENTNNDPRAKLFVGGLNRETTNETLREYFEAY 37 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRT----IGGKEVDVKRATPKPD 663 D + +GF ++TF +V ++LK I GKEV+VKRA P+ D Sbjct: 48 DSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDD 98 Score = 34.3 bits (75), Expect = 0.094 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK------PDGPGGIGT 684 D+TK+ +GF F+ +E ++L K + GK V+ K+ATP+ G GG G Sbjct: 147 DETKH--RGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPRDRNSPADGGRGGYGG 204 Query: 685 R 687 R Sbjct: 205 R 205 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E +++ +R +F +G + + Sbjct: 15 KLFVGGLNRETTNETLREYFEAYGELTD 42 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 38.3 bits (85), Expect = 0.006 Identities = 25/87 (28%), Positives = 38/87 (43%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F E+ES+ + G SR + F++FK + K + H IN Sbjct: 100 FEQFGEVESVRIMRT-FLGYSRNYGFVLFK-DDGPSKEVLKKSHVINGKTVDVGKSR-NF 156 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTI 502 I+VGGL S ++ +R F +FG I Sbjct: 157 RVIYVGGLPSHFTEQTVREHFKKFGVI 183 Score = 31.1 bits (67), Expect = 0.87 Identities = 10/41 (24%), Positives = 24/41 (58%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 379 ++ +++ TD TG+S+G + + P +++K++ H I Sbjct: 344 QVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPVHVI 384 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 +FVGGL+S ++ ++++F +FG + Sbjct: 82 VFVGGLASGTDEEGLKDYFEQFGEV 106 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 263 ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 E++N+ TD TGR RGF F+ F + E ++K + Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAI 154 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 675 D+ + +GF F+TF S E++ + + + + G+ + V A P+ D GG Sbjct: 130 DRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEAKPRGDSGGG 181 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 37.1 bits (82), Expect = 0.013 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGG+ E DD +R FF++FG I E Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFGEIRE 38 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 672 F++ KGF F+TF + +L + GK +D K A P+ GPG Sbjct: 134 FERRARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR--GPG 182 Score = 35.1 bits (77), Expect = 0.054 Identities = 12/29 (41%), Positives = 23/29 (79%) Frame = +3 Query: 168 GRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G +D K+F+GGL++ TT+++L+++F Y Sbjct: 197 GSANDGKVFIGGLAFGTTEEDLKEYFSTY 225 Score = 32.3 bits (70), Expect = 0.38 Identities = 19/87 (21%), Positives = 39/87 (44%), Gaps = 21/87 (24%) Frame = +2 Query: 305 RGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXR---------------------H 421 +GF F+ F+ P +I+ V+A H ++ R Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSAND 201 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTI 502 GK+F+GGL+ ++++++ +FS +G + Sbjct: 202 GKVFIGGLAFGTTEEDLKEYFSTYGMV 228 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/94 (20%), Positives = 42/94 (44%), Gaps = 6/94 (6%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM------AAGEHTINNXXXXXX 403 F ++ + S + D TG+S G+AF+ + P+ +K + T+ Sbjct: 47 FGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPS 106 Query: 404 XXXXRHGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 ++ +++ GL ++ ++E+ F FG I+ Sbjct: 107 STEIKNANLYISGLPKDMKEEEVEALFKPFGKII 140 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 36.3 bits (80), Expect = 0.023 Identities = 22/85 (25%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAAGEHTINNXXXXXXXXXXRHGKIF 433 EI ++ DP TG ++GFAF F + + + + I + ++F Sbjct: 178 EIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAITTLNDKDIRPGRRLAICKSRSNSRLF 237 Query: 434 VGGLSSEISDDEIRNFFSEFGTILE 508 V G+ S +EI FS+ T L+ Sbjct: 238 VKGIPKRKSKEEIFQEFSKVTTDLQ 262 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 35.5 bits (78), Expect = 0.041 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESI 346 +E++ + TD NTG+ R F F+ F +P S+ Sbjct: 483 LENVRIPTDKNTGQQRSFGFVEFSSPVSV 511 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.1 bits (77), Expect = 0.054 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 266 SINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 S+ V TD TGR RGF F+ F + + +DK + Sbjct: 37 SVKVITDRETGRPRGFGFVTFGSEDEMDKAI 67 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPGG 675 L +++ D+ + +GF F+TF SE ++ + K + G+ + V +A P+ + GG Sbjct: 36 LSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPRGERGGG 94 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPGGIG 681 D+ + +GF F+TF S++ + D + + + G+ + V +A + GG G Sbjct: 263 DRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSREQRGGGRG 316 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 34.3 bits (75), Expect = 0.094 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 ++ + V TD TGR RGF F+ F + E ++K + Sbjct: 29 DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAI 62 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +I S+ V TDP G+S+GF F+ F+ PE ++ + Sbjct: 134 KIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV 166 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 I S V D + G S+GF F+ F +PE K + Sbjct: 238 ISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAV 269 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTI-LEW 511 K+FVGGL +I +DEI F FG++ ++W Sbjct: 345 KVFVGGLPPDIDEDEIHASFCRFGSLTVDW 374 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 33.5 bits (73), Expect = 0.16 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 ++F+G L S + D ++ FS++GTILE Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTILE 385 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 31.9 bits (69), Expect = 0.50 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 +FVG + E S+++++ FSE G ++ +R ++ K + Sbjct: 27 VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPK 66 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 31.9 bits (69), Expect = 0.50 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 +IFV G + E ++ E+R FF E+G + E Sbjct: 9 RIFVKGFNRETTESELRAFFEEYGVVKE 36 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 171 RDDDRKLFVGGLSWETTDKELRDHFGAY 254 +D +++FV G + ETT+ ELR F Y Sbjct: 4 QDISKRIFVKGFNRETTESELRAFFEEY 31 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 31.9 bits (69), Expect = 0.50 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 523 DKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D KN+ KGF F++F E + + TIGGK+V A K Sbjct: 547 DPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARK 592 Score = 31.9 bits (69), Expect = 0.50 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILE 508 ++VG L ++ D E++ FS++G+ILE Sbjct: 617 VYVGNLPPDVKDYELQQMFSQYGSILE 643 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 31.1 bits (67), Expect = 0.87 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVG +S ++++R FS FGTI E Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGTIEE 242 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.1 bits (67), Expect = 0.87 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESI 346 +E +++ D +GRSRGF F++ ++ + I Sbjct: 34 VEKVDILRDKESGRSRGFGFVLLQSADQI 62 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 31.1 bits (67), Expect = 0.87 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTI 502 KIF+GGL + +++D+++ S FG + Sbjct: 674 KIFIGGLPNYLNEDQVKELLSSFGEL 699 >SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 66 NDNFAQDITTDNQLNGNAENGGGDSQDH-NSAEAPGRDDD 182 ND+ DI D+ NGN + G D+ D N E G DDD Sbjct: 20 NDDDGDDIDDDDG-NGNGNDNGDDNDDDDNDDEGNGDDDD 58 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/70 (30%), Positives = 34/70 (48%) Frame = -2 Query: 369 SPAAMTLSIDSGALNTMKANPRDLPVFGSVFTLILSISRMLQNDHGAPYLWSPSSAHQQK 190 SP A++ +D G +A +++P F TL L + G P ++PSS H++ Sbjct: 371 SPDALSKGLDMGWGALSRAGVQEMPAFP---TLRLPLHPFASTGFGTPAFYNPSSYHRE- 426 Query: 189 VFCRHRVLGP 160 + VLGP Sbjct: 427 ---YYPVLGP 433 >SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAE----NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKE 230 +ND D D+++NG + N GGD D + + DDD + G S++ D + Sbjct: 58 DNDGGDDDDDDDDEVNGGNDDDDFNNGGDCDDDDDDDDDDDDDDDDINKKGASYDDDDDD 117 Query: 231 LRDHF 245 D + Sbjct: 118 DDDGY 122 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPKPDGPGGIGTR 687 FD+ + +GF F+ ++ + +L + + G++V + A+P+ +G G G R Sbjct: 319 FDRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFASPRTEGGGRGGGR 375 >SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Frame = -3 Query: 674 PPGPSGFGVARFTSTSFPPIVLL---GVLSKSFTTCSDSNVMKQKPFLWFFVLSK 519 P G +G G+ R++S S P G +S S+T V ++ FL FFVL K Sbjct: 383 PIGVNGSGITRYSSLSVPFYCKFSSHGDVSLSYTIKKSVPVWHEEKFLSFFVLYK 437 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 G I++G + ++EI+ FF +FGT+ R +K+ + + Sbjct: 98 GVIYLGHIPHGFFENEIKKFFEQFGTVNRIRLSRSKKSARSK 139 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +3 Query: 189 LFVGGLSWETTDKELRDHF 245 L+VGGL + T+++LRDHF Sbjct: 306 LYVGGLEGKVTEQDLRDHF 324 Score = 28.3 bits (60), Expect = 6.2 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 ++VGGL ++++ ++R+ F +FG + Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGEL 330 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKL--------FVGGLSWE 215 NN+N D +DN + N++N ++ D+N+ R D ++ ++ GL+WE Sbjct: 613 NNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSERGADPEIKRGKNPEGWIRGLNWE 671 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 NNDN + + +N N N N ++ D+NS + D Sbjct: 597 NNDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSDNNSD 636 >SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 NN+N + +N N N N ++ D NS E DDD Sbjct: 18 NNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDDDDDD 57 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 ++++++ TD SRGFA++ + PE +K + Sbjct: 1183 VKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 508 MEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATP 654 +++P D+T N +GF ++ + + E+ L I G+E+ V+ P Sbjct: 1186 VDLPTDRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQSVLP 1235 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 29.5 bits (63), Expect = 2.7 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 7/90 (7%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESID---KVM----AAGEHTINNXXXXXXXXXXR 418 + ++++ D T +G+ F+ F E D KVM G+ N Sbjct: 39 VVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDV 98 Query: 419 HGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 +F+G L +E+ + + + FS FG IL+ Sbjct: 99 GANLFIGNLDTEVDEKLLYDTFSAFGVILQ 128 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN 382 +++ + D +TG S+GFAFI F + ++ D + A G++ N Sbjct: 127 LQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCN 169 >SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAE-NGGGDSQDHNS 155 NND+ D T D+ N N + NGGG D+N+ Sbjct: 193 NNDDDDDDDTDDDDHNNNDDDNGGGGDDDNNN 224 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 66 NDNFAQDITTDNQLN-GNAENGGGDSQDHNS 155 +DNF DI+ D LN G A N + ++NS Sbjct: 335 HDNFNDDISNDGNLNGGGANNNNNKNNNYNS 365 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 29.1 bits (62), Expect = 3.5 Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 2/90 (2%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNXXXXXXXXX 412 SF + +++K P G+ +AF+ F + K A G+ N Sbjct: 256 SFEKFGVVLDVDIKR-PARGQGNTYAFVKFADLDVAAKAKCAMQGQCIGRNHIKIGYGRS 314 Query: 413 XRHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 + +++VGGL IS E+ F FG I Sbjct: 315 QQTTRLWVGGLGPWISIPELEREFDRFGAI 344 >SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) Length = 189 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 NN+N +I +N N N N ++ ++N+ + DDD Sbjct: 112 NNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNDDDDDDDD 151 >SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) Length = 244 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 60 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 A N+ +A+ +T +N N N N ++ ++N+ DDD Sbjct: 160 AINEKYAKIMTDNNNNNNNNNNNNNNNNNNNNNNNNNNDDD 200 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 28.7 bits (61), Expect = 4.7 Identities = 9/33 (27%), Positives = 22/33 (66%) Frame = +1 Query: 505 RMEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 603 ++++ +D + Q KGFCF+T +++ + ++T Sbjct: 303 KVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQT 335 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 28.7 bits (61), Expect = 4.7 Identities = 20/78 (25%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVF-KAPESIDKVMAAGEHTINNXXXXXXXXXXRHGKIFV 436 I + DP +G ++GFAF F E+ + V I + ++FV Sbjct: 178 IYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAVKKLDNKEIRPGKRLGVCISVANSRLFV 237 Query: 437 GGLSSEISDDEIRNFFSE 490 G + S EI FS+ Sbjct: 238 GSIPKTKSKQEILEEFSK 255 >SB_25359| Best HMM Match : p450 (HMM E-Value=0) Length = 1084 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = -2 Query: 264 SISRMLQNDHGAPYLWSPSSAHQQKVFCRHRVLGPQHCYDLANHRHRSL 118 SIS + ++ G P L+ P A Q ++ CR + LG + L ++H S+ Sbjct: 498 SISSIYLHNFGPPVLFEPQKA-QPQLSCRIKTLGTRLASILIVYKHMSV 545 >SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 251 IREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 I I+ + K+ N G++ G AF+VFK+ K + Sbjct: 358 IASIDLLKHKSGKNQGKNTGVAFVVFKSNNDASKAL 393 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPES 343 + + V TD TGR RGF F+ +A ++ Sbjct: 107 VVDVRVITDRETGRPRGFGFVTLEAKKT 134 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/35 (25%), Positives = 22/35 (62%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESI 346 F + +ES+ + D TG +GF +++F++ +++ Sbjct: 76 FTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAV 110 >SB_57208| Best HMM Match : Ion_trans (HMM E-Value=5.5e-34) Length = 722 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = -2 Query: 366 PAAMTLSIDSGALNTMKANPRDLPVF-GSVFTLILSISRMLQNDHGAPYLWSPSSAHQQK 190 P+A++ +I K P LPV G+ +T S +N H YLW H + Sbjct: 530 PSAVSGTISPYLDIVNKYTPHGLPVVRGNEYTPHGSPVARGKNTHKTGYLWPRERIHTTR 589 Query: 189 VFCRH 175 V C H Sbjct: 590 VTCCH 594 >SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 ++DN D DN NG+ ++ D D + +A DDD Sbjct: 61 DSDNNYDDNDDDNDDNGDDDDNDDDDDDDDDDDADDDDDD 100 >SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 69 DNFAQDITTDNQLNGNAENGG-GDSQDHNSAEAPGRDDD 182 D + D D+ + + +N G GD D+ AE G DDD Sbjct: 821 DYYYDDDDDDDDDDDDGDNDGDGDGDDYGDAENYGEDDD 859 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +1 Query: 496 NYLRMEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 669 +YLR ++ KT++ F+S+ + + K G +VD + TP+PD P Sbjct: 107 DYLRTKVTSSKTESDTD--VNKEFDSDDDREETIDASKNPDGSSDVDEPQETPQPDKP 162 >SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) Length = 599 Score = 28.3 bits (60), Expect = 6.2 Identities = 9/30 (30%), Positives = 22/30 (73%) Frame = +3 Query: 66 NDNFAQDITTDNQLNGNAENGGGDSQDHNS 155 ND+ A D++ ++ + G+ +NGG D+ ++++ Sbjct: 180 NDDSASDVSIEDIIYGDDDNGGDDNDNYDN 209 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 293 TGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 TG+S+GF ++ ++ ES + + AG H I+ Sbjct: 99 TGKSKGFGYVTYENAESAQRAL-AGTHIID 127 >SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -3 Query: 185 SVVIASWGLSTVMILRITATVLCISIKLV 99 ++++ S G++ L ITAT+LC SI L+ Sbjct: 267 TILLESSGVTLPKALHITATILCYSISLL 295 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +3 Query: 123 NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRD 239 NGG + D + A R++ +LFV GL E ++ +LR+ Sbjct: 603 NGGKSTDDASDAAYELRNEGVELFVVGLGDENSEAQLRE 641 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 +IF G L SE++D+ + F+++ + L+ + K+ K + Sbjct: 218 RIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSK 258 >SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) Length = 691 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQD 146 +++++A D DN +NG+ ++GGGD D Sbjct: 585 DDEDYAGD--GDNDVNGDGDSGGGDDDD 610 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPES 343 EI ++N+ D TG+ +GF F+ ++ S Sbjct: 4 EIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 K+FVG + ++ E+++FF FG ++ + R K+R+ Sbjct: 80 KVFVGNIGFKVRARELKDFFGYFGDVV--YAQIIMDRVKKRS 119 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPES 343 EI ++N+ D TG+ +GF F+ ++ S Sbjct: 4 EIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 >SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) Length = 557 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 182 +N+N +DI N EN GG+S + N + DD+ Sbjct: 147 SNNNEDEDIQEVEDDNEGKENDGGESDEENDDDDEDGDDE 186 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 654 WCCTLHIDLLSTNCSFGSLKQIIYNL 577 WC D+L+T CS GS++ ++ L Sbjct: 3068 WCLDCRGDILATGCSDGSVEVVVARL 3093 >SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGN--AENGGGDSQDHN 152 NNDN+ + DN N N NG DS D+N Sbjct: 90 NNDNYDNNGNNDNNDNYNNYDNNGNNDSNDNN 121 >SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) Length = 521 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 60 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 188 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 103 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 144 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 60 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 188 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 289 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 330 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,324,697 Number of Sequences: 59808 Number of extensions: 456298 Number of successful extensions: 2891 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 1445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2692 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -