BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00714 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 55 4e-08 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 55 4e-08 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 54 1e-07 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 48 4e-06 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 46 2e-05 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 46 3e-05 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 46 3e-05 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 44 7e-05 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 44 1e-04 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 44 1e-04 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 43 2e-04 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 43 2e-04 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 43 2e-04 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 43 2e-04 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 43 2e-04 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 42 5e-04 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 42 5e-04 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 41 7e-04 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 40 0.002 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 40 0.002 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 40 0.002 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 40 0.002 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 39 0.003 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 39 0.004 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 39 0.004 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 39 0.004 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 39 0.004 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 38 0.005 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 38 0.006 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 38 0.006 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 36 0.019 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 36 0.019 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 36 0.025 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 36 0.025 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 36 0.033 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 36 0.033 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 36 0.033 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 36 0.033 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 35 0.044 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 35 0.058 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 35 0.058 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 35 0.058 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 35 0.058 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 34 0.077 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 34 0.10 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 34 0.10 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 34 0.10 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 34 0.10 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 34 0.10 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 34 0.10 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 34 0.10 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 34 0.10 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 34 0.10 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 33 0.13 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 33 0.13 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 33 0.13 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 33 0.13 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 33 0.13 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 33 0.13 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 33 0.13 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 33 0.18 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 33 0.18 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 33 0.23 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 33 0.23 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 32 0.31 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 32 0.31 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 32 0.41 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 32 0.41 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 32 0.41 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 32 0.41 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 32 0.41 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 32 0.41 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 32 0.41 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 31 0.54 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 31 0.54 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 31 0.54 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 31 0.54 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 31 0.54 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 31 0.72 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 31 0.72 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 31 0.72 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 31 0.72 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 31 0.72 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 31 0.95 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 31 0.95 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 0.95 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 31 0.95 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 31 0.95 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 30 1.3 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 30 1.3 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 30 1.3 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 30 1.3 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 30 1.3 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 30 1.3 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 30 1.3 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 30 1.3 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 30 1.7 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 30 1.7 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 30 1.7 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 30 1.7 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 30 1.7 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 30 1.7 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 30 1.7 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 30 1.7 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 30 1.7 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 30 1.7 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 30 1.7 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 30 1.7 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 29 2.2 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 2.2 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 29 2.2 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 29 2.2 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 29 2.2 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 29 2.2 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 2.2 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 29 2.9 At2g47390.1 68415.m05915 expressed protein 29 2.9 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 29 2.9 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 29 2.9 At5g43420.1 68418.m05309 zinc finger (C3HC4-type RING finger) fa... 29 3.8 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 29 3.8 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 29 3.8 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 29 3.8 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 29 3.8 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 29 3.8 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 5.0 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 28 5.0 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 28 5.0 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 28 5.0 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 28 5.0 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 28 5.0 At2g33440.1 68415.m04099 splicing factor family protein similar ... 28 5.0 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 28 5.0 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 28 5.0 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.0 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.0 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 28 5.0 At5g22830.1 68418.m02669 magnesium transporter CorA-like family ... 28 6.7 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 28 6.7 At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing ... 28 6.7 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 27 8.8 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 27 8.8 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 27 8.8 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 27 8.8 At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein ... 27 8.8 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 27 8.8 At1g62170.1 68414.m07013 serpin family protein / serine protease... 27 8.8 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 27 8.8 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 27 8.8 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 27 8.8 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 55.2 bits (127), Expect = 4e-08 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 11/100 (11%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F EI + D +TG+ RGF FI F P +DKV+ H IN + Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPKG 97 Query: 422 G-----------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGG+ S +++DE+++FF+++G ++E Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVE 137 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 675 D+ Q +GF FITF VV+ +++ I GK+V++KR PK G GG Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK--GAGG 100 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +1 Query: 496 NYLRMEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPK 657 N + ++ D N+ +GF F+ F+SE+VV++LL K + +V++K+A PK Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Score = 33.9 bits (74), Expect = 0.10 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAAG 367 D T RSRGF F++F + E +D++++ G Sbjct: 143 DHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 30.7 bits (66), Expect = 0.95 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 129 GGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G S++ N G K+F+GGL +TT+ HFG Y Sbjct: 2 GSRSRNDNFQSGDGASPG-KIFIGGLHKDTTNTVFNKHFGKY 42 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 +K+FVGG+ T+ EL+D F Y Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKY 132 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GKIF+GGL + ++ F ++G I + Sbjct: 19 GKIFIGGLHKDTTNTVFNKHFGKYGEITD 47 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 55.2 bits (127), Expect = 4e-08 Identities = 32/100 (32%), Positives = 50/100 (50%), Gaps = 11/100 (11%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F EI + D +TG+ RGF FI F P +DKV+ H IN + Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPKG 97 Query: 422 G-----------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGG+ S +++DE+++FF+++G ++E Sbjct: 98 AGGNQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYGNVVE 137 Score = 39.5 bits (88), Expect = 0.002 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 675 D+ Q +GF FITF VV+ +++ I GK+V++KR PK G GG Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK--GAGG 100 Score = 33.9 bits (74), Expect = 0.10 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAAG 367 D T RSRGF F++F + E +D++++ G Sbjct: 143 DHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 31.1 bits (67), Expect = 0.72 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +1 Query: 496 NYLRMEMPFDKTKNQRKGFCFITFESEQVVNDLL 597 N + ++ D N+ +GF F+ F+SE+VV++LL Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 Score = 30.7 bits (66), Expect = 0.95 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 129 GGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G S++ N G K+F+GGL +TT+ HFG Y Sbjct: 2 GSRSRNDNFQSGDGASPG-KIFIGGLHKDTTNTVFNKHFGKY 42 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 +K+FVGG+ T+ EL+D F Y Sbjct: 109 KKIFVGGIPSTVTEDELKDFFAKY 132 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GKIF+GGL + ++ F ++G I + Sbjct: 19 GKIFIGGLHKDTTNTVFNKHFGKYGEITD 47 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 53.6 bits (123), Expect = 1e-07 Identities = 23/54 (42%), Positives = 35/54 (64%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 681 +D+ N+ +GF F++F+SE V+ +L + GK+V+VKRA PK PGG G Sbjct: 143 YDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKDANPGGGG 196 Score = 40.7 bits (91), Expect = 9e-04 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +3 Query: 177 DDRKLFVGGLSWETTDKELRDHFGAY 254 D KLFVGG+SWET + +LR+HF Y Sbjct: 4 DQGKLFVGGISWETDEDKLREHFTNY 29 Score = 39.1 bits (87), Expect = 0.003 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 24/113 (21%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKV-----------------MAAGE 370 F + E+ V D TGR RGF F++F P +D+V M+ E Sbjct: 26 FTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQEKHSIDTREVDVKRAMSREE 85 Query: 371 HTINNXXXXXXXXXXRHG-------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 ++ G KIFVGGL ++D+E R +F +G + + Sbjct: 86 QQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEVYGPVTD 138 Score = 34.3 bits (75), Expect = 0.077 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTI 502 GK+FVGG+S E +D++R F+ +G + Sbjct: 6 GKLFVGGISWETDEDKLREHFTNYGEV 32 Score = 33.5 bits (73), Expect = 0.13 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 DK + +GF F+ F V++ +L+ K +I +EVDVKRA + + Sbjct: 40 DKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSREE 85 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Frame = +3 Query: 81 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRD---DDRKLFVGGLSWETTDKELRDHFGA 251 +++ ++ + G + + N++ + G D +K+FVGGL TD+E R +F Sbjct: 73 REVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEV 132 Query: 252 Y 254 Y Sbjct: 133 Y 133 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 48.4 bits (110), Expect = 4e-06 Identities = 31/98 (31%), Positives = 42/98 (42%), Gaps = 9/98 (9%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F EI + D TG+ RGF F+ + +DKV+ H I R Sbjct: 62 FGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPRG 120 Query: 422 G---------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGG+ S + DDE + FF +FG + E Sbjct: 121 SMSSNDFKTKKIFVGGIPSSVDDDEFKEFFMQFGELKE 158 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKR-TIGGKEVDVKRATPK 657 D + + +GF F+T+ESE +V+ LL R + G +V++K+A PK Sbjct: 164 DHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 38.3 bits (85), Expect = 0.005 Identities = 22/58 (37%), Positives = 30/58 (51%) Frame = +3 Query: 81 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 +D D + + + E+ SQ H+ G D K+FVGGL+ ETT E HFG Y Sbjct: 11 EDEIHDPKPSEDIEDDDDKSQPHSGG---GVDSAGKIFVGGLARETTSAEFLKHFGKY 65 Score = 38.3 bits (85), Expect = 0.005 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 367 F E++ + D +TGRSRGF F+ +++ + +D ++A G Sbjct: 150 FMQFGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKG 191 Score = 34.3 bits (75), Expect = 0.077 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D+ Q +GF F+T+ VV+ +++ I GK+V++KR P+ Sbjct: 76 DRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPR 119 Score = 30.7 bits (66), Expect = 0.95 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GKIFVGGL+ E + E F ++G I + Sbjct: 42 GKIFVGGLARETTSAEFLKHFGKYGEITD 70 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/50 (42%), Positives = 32/50 (64%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 672 D+T + +GF F++F+SE V+ +L + GK+V+VKRA PK PG Sbjct: 144 DQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPKDANPG 193 Score = 41.1 bits (92), Expect = 7e-04 Identities = 31/111 (27%), Positives = 43/111 (38%), Gaps = 24/111 (21%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH---------------- 373 F + E+ + V + TGR RGF F+ F P ID+V+ H Sbjct: 26 FSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQDKHHIDNRDVDVKRAMSREE 85 Query: 374 --------TINNXXXXXXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 T N R KIFVGGL ++ DE R +F +G + Sbjct: 86 QSPAGRSGTFNASRNFDSGANVRTKKIFVGGLPPALTSDEFRAYFETYGPV 136 Score = 35.5 bits (78), Expect = 0.033 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+F+GG+S + ++ +R +FS FG +L+ Sbjct: 6 GKLFIGGISWDTDENLLREYFSNFGEVLQ 34 Score = 34.7 bits (76), Expect = 0.058 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 177 DDRKLFVGGLSWETTDKELRDHFGAY 254 D KLF+GG+SW+T + LR++F + Sbjct: 4 DQGKLFIGGISWDTDENLLREYFSNF 29 Score = 32.7 bits (71), Expect = 0.23 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GPGG 675 L++ + +K + +GF F+ F V++ +L+ K I ++VDVKRA + + P G Sbjct: 33 LQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQD-KHHIDNRDVDVKRAMSREEQSPAG 90 Score = 31.5 bits (68), Expect = 0.54 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 + D T R RGF F+ F + +S+D V+ H +N Sbjct: 141 IMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLN 176 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 672 +D + +GF FIT++SE+ V +L + GK V+VKRA PK PG Sbjct: 141 YDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPG 191 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/44 (36%), Positives = 30/44 (68%) Frame = +2 Query: 419 HGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 +GK+F+GG+S + +++ ++ +FS FG ++E + K RT RA Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGEVIE--AVILKDRTTGRA 46 Score = 37.9 bits (84), Expect = 0.006 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 22/108 (20%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAP----------ESIDKVMAAGEHTI---- 379 F S E+ + D TGR+RGF F+VF P +ID + + + Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITEKHNIDGRLVEAKKAVPRDD 85 Query: 380 --------NNXXXXXXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFGT 499 ++ R KIFVGGL S +++ + + +F +FGT Sbjct: 86 QNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGT 133 Score = 37.5 bits (83), Expect = 0.008 Identities = 11/28 (39%), Positives = 23/28 (82%) Frame = +3 Query: 171 RDDDRKLFVGGLSWETTDKELRDHFGAY 254 + D+ KLF+GG+SW+T ++ L+++F ++ Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEYFSSF 29 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 114 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 N N S S PGR RK+FVGGL T+ + + +F Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYF 128 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 672 +D + +GF FIT++SE+ V +L + GK V+VKRA PK PG Sbjct: 141 YDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPKELSPG 191 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/44 (36%), Positives = 30/44 (68%) Frame = +2 Query: 419 HGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 +GK+F+GG+S + +++ ++ +FS FG ++E + K RT RA Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGEVIE--AVILKDRTTGRA 46 Score = 37.9 bits (84), Expect = 0.006 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 22/108 (20%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAP----------ESIDKVMAAGEHTI---- 379 F S E+ + D TGR+RGF F+VF P +ID + + + Sbjct: 26 FSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITEKHNIDGRLVEAKKAVPRDD 85 Query: 380 --------NNXXXXXXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFGT 499 ++ R KIFVGGL S +++ + + +F +FGT Sbjct: 86 QNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGT 133 Score = 37.5 bits (83), Expect = 0.008 Identities = 11/28 (39%), Positives = 23/28 (82%) Frame = +3 Query: 171 RDDDRKLFVGGLSWETTDKELRDHFGAY 254 + D+ KLF+GG+SW+T ++ L+++F ++ Sbjct: 2 QSDNGKLFIGGISWDTNEERLKEYFSSF 29 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 114 NAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 N N S S PGR RK+FVGGL T+ + + +F Sbjct: 87 NMVNRSNSSSIQGSPGGPGRT--RKIFVGGLPSSVTESDFKTYF 128 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 44.4 bits (100), Expect = 7e-05 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 12/101 (11%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F E+ + TD TG RGF F+ F +KV+ +H I++ R Sbjct: 86 FGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE-DHVIDDRKVDLKRTLPRG 144 Query: 422 GK------------IFVGGLSSEISDDEIRNFFSEFGTILE 508 K IFVGGL + +DE++N+F +G I+E Sbjct: 145 DKDTDIKAVSKTRKIFVGGLPPLLEEDELKNYFCVYGDIIE 185 Score = 40.7 bits (91), Expect = 9e-04 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +1 Query: 511 EMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDG 666 ++ +D + +GF F+TF++E V+ L K +G K+V++KRA PK G Sbjct: 187 QIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPKRTG 239 Score = 38.7 bits (86), Expect = 0.004 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 5/60 (8%) Frame = +3 Query: 90 TTDNQLNGNA--ENGG---GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 T D++ NG A + GG S DH + + KLFVGG+SWETT + ++FG + Sbjct: 31 TFDDRRNGGAAVDTGGIQMKHSVDHRHSSS-SMSSPGKLFVGGVSWETTAETFANYFGKF 89 Score = 36.7 bits (81), Expect = 0.014 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = +2 Query: 284 DPNTGRSRGFAFIVFKAPESIDKVMAAGE 370 D +TGRSRGF F+ F+ +S+D++ + G+ Sbjct: 191 DHHTGRSRGFGFVTFQTEDSVDRLFSDGK 219 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+FVGG+S E + + N+F +FG +++ Sbjct: 66 GKLFVGGVSWETTAETFANYFGKFGEVVD 94 Score = 31.1 bits (67), Expect = 0.72 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 D+ +GF F+TF V +L+ I ++VD+KR P+ D Sbjct: 100 DRITGNPRGFGFVTFADSAVAEKVLE-EDHVIDDRKVDLKRTLPRGD 145 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 43.6 bits (98), Expect = 1e-04 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 20/109 (18%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-----------------GE 370 F S E+ + D TGR+RGF F+VF P ++V+ + Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLKHIIDGKIVEAKKAVPRDD 85 Query: 371 HTI---NNXXXXXXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 H + +N KIFVGGL+S +++ E + +F++FG I + Sbjct: 86 HVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITD 134 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 K+F+GG+S E S+D +R++F FG +LE + K R RA Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLE--AVIMKDRATGRA 46 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 139 YDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 37.9 bits (84), Expect = 0.006 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SWET++ LRD+F ++ Sbjct: 7 KLFIGGISWETSEDRLRDYFHSF 29 Score = 34.7 bits (76), Expect = 0.058 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 I + V D T R RGF FI + + E++DKV+ H +N Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELN 172 Score = 31.5 bits (68), Expect = 0.54 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 162 APGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 +PG + +K+FVGGL+ T+ E + +F + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQF 129 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 43.6 bits (98), Expect = 1e-04 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 20/109 (18%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-----------------GE 370 F S E+ + D TGR+RGF F+VF P ++V+ + Sbjct: 26 FHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLKHIIDGKIVEAKKAVPRDD 85 Query: 371 HTI---NNXXXXXXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 H + +N KIFVGGL+S +++ E + +F++FG I + Sbjct: 86 HVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFGMITD 134 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 K+F+GG+S E S+D +R++F FG +LE + K R RA Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFGEVLE--AVIMKDRATGRA 46 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 139 YDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 37.9 bits (84), Expect = 0.006 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SWET++ LRD+F ++ Sbjct: 7 KLFIGGISWETSEDRLRDYFHSF 29 Score = 34.7 bits (76), Expect = 0.058 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 I + V D T R RGF FI + + E++DKV+ H +N Sbjct: 132 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELN 172 Score = 31.5 bits (68), Expect = 0.54 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 162 APGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 +PG + +K+FVGGL+ T+ E + +F + Sbjct: 99 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQF 129 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 43.2 bits (97), Expect = 2e-04 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 25/108 (23%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXR------- 418 +E++ + D TGR+RGF FIVF P ++V+ +H I+ R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 419 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 669 +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 143 YDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 37.9 bits (84), Expect = 0.006 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SW+T ++ LRD+F Y Sbjct: 7 KLFIGGISWDTDEERLRDYFSNY 29 Score = 36.3 bits (80), Expect = 0.019 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 Score = 36.3 bits (80), Expect = 0.019 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 I + V D NT R RGF FI F + +++D+V+ H +N Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELN 176 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 43.2 bits (97), Expect = 2e-04 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 25/108 (23%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXR------- 418 +E++ + D TGR+RGF FIVF P ++V+ +H I+ R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 419 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 669 +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 143 YDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 37.9 bits (84), Expect = 0.006 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SW+T ++ LRD+F Y Sbjct: 7 KLFIGGISWDTDEERLRDYFSNY 29 Score = 36.3 bits (80), Expect = 0.019 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 Score = 36.3 bits (80), Expect = 0.019 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 I + V D NT R RGF FI F + +++D+V+ H +N Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELN 176 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 43.2 bits (97), Expect = 2e-04 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 25/108 (23%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXR------- 418 +E++ + D TGR+RGF FIVF P ++V+ +H I+ R Sbjct: 33 VEAV-IMRDRATGRARGFGFIVFADPCVSERVIM-DKHIIDGRTVEAKKAVPRDDQQVLK 90 Query: 419 ------------HG------KIFVGGLSSEISDDEIRNFFSEFGTILE 508 HG KIFVGGL S I+++E +N+F +FGTI + Sbjct: 91 RHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGTIAD 138 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGP 669 +D + +GF FITF+S+ V+ +L + GK V+VKRA PK P Sbjct: 143 YDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPKEISP 192 Score = 37.9 bits (84), Expect = 0.006 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SW+T ++ LRD+F Y Sbjct: 7 KLFIGGISWDTDEERLRDYFSNY 29 Score = 36.3 bits (80), Expect = 0.019 Identities = 11/29 (37%), Positives = 23/29 (79%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILE 508 GK+F+GG+S + ++ +R++FS +G ++E Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYGDVVE 34 Score = 36.3 bits (80), Expect = 0.019 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 I + V D NT R RGF FI F + +++D+V+ H +N Sbjct: 136 IADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELN 176 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 9/97 (9%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH----- 421 ++E V D +TGRSRGF ++ F + E + GEH + N + Sbjct: 28 DLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKVATPKEEMRQP 86 Query: 422 ----GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCP 520 +IFV + S +S+ + R+ F +G I + P Sbjct: 87 AKKVTRIFVARIPSSVSESDFRSHFERYGEITDLYMP 123 Score = 42.7 bits (96), Expect = 2e-04 Identities = 23/50 (46%), Positives = 27/50 (54%) Frame = +1 Query: 514 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 MP D Q +G FITF S V DL++ +GG V V RATPK D Sbjct: 122 MPKDYNSKQHRGIGFITFSSADSVEDLME-DTHDLGGTTVAVDRATPKED 170 Score = 35.1 bits (77), Expect = 0.044 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 KIFVG L E S D++R++F FG I + P +R+ R Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRSGHR 281 Score = 32.3 bits (70), Expect = 0.31 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 D++ + +GF ++TF S + + LK + +G + ++VK ATPK + Sbjct: 37 DRSTGRSRGFGYVTFASAEDAKNALK-GEHFLGNRILEVKVATPKEE 82 Score = 31.5 bits (68), Expect = 0.54 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +1 Query: 514 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD-GP 669 +P D ++ +GF F+TF +E V D + I G+EV + ATP + GP Sbjct: 271 IPKDPKRSGHRGFGFVTF-AENGVADRVARRSHEICGQEVAIDSATPLDEAGP 322 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 147 HNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 + E R K+FVG L E + +LRD+FG + Sbjct: 228 YGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRF 263 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FITF+SE+ V+ +L + GK V+VKRA PK Sbjct: 155 YDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPK 200 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = +2 Query: 416 RHGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 R KIFVGGL S I++ E +N+F +FGTI + Sbjct: 120 RTKKIFVGGLPSSITEAEFKNYFDQFGTIAD 150 Score = 37.5 bits (83), Expect = 0.008 Identities = 12/23 (52%), Positives = 20/23 (86%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GG+SW+T ++ L+++FG Y Sbjct: 16 KLFIGGISWDTDEERLQEYFGKY 38 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 I + V D NT R RGF FI F + ES+D V+ H +N Sbjct: 148 IADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELN 188 Score = 34.3 bits (75), Expect = 0.077 Identities = 13/43 (30%), Positives = 28/43 (65%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKERA 550 GK+F+GG+S + ++ ++ +F ++G ++E + + RT RA Sbjct: 15 GKLFIGGISWDTDEERLQEYFGKYGDLVE--AVIMRDRTTGRA 55 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPD 663 D+T + +GF FI F V ++ K I G+ V+ K+A P+ D Sbjct: 49 DRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRDD 94 Score = 32.3 bits (70), Expect = 0.31 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +E++ + D TGR+RGF FIVF P ++V+ Sbjct: 42 VEAV-IMRDRTTGRARGFGFIVFADPSVAERVI 73 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 41.5 bits (93), Expect = 5e-04 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 8/109 (7%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNXXXX 397 F ++ +N+ D T SRG F++ + E DK++ A G +++ Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 398 XXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKE 544 K+FVG L +S+ E+++ FS++GTI + + Q+T + Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSK 146 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 41.5 bits (93), Expect = 5e-04 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 8/109 (7%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNXXXX 397 F ++ +N+ D T SRG F++ + E DK++ A G +++ Sbjct: 38 FQEFAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYA 97 Query: 398 XXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKE 544 K+FVG L +S+ E+++ FS++GTI + + Q+T + Sbjct: 98 DGELERLEHKLFVGMLPKNVSEAEVQSLFSKYGTIKDLQILRGAQQTSK 146 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = +2 Query: 419 HGKIFVGGLSSEISDDEIRNFFSEFGTILE 508 H K+FVGGL+ E DE+R +F +FG ILE Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQFGEILE 45 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGGL+WET E+R +F + Sbjct: 18 KVFVGGLAWETPTDEMRRYFDQF 40 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGPGGIG 681 DK + KG+ F+TF + P I G++ + A+ P+P P G G Sbjct: 51 DKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKANCNIASFGRPRPSTPRGRG 106 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 EI + TD TG+S+G+ F+ F+ +S + +A Sbjct: 42 EILEAVIITDKATGKSKGYGFVTFRDSDSATRAVA 76 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/35 (42%), Positives = 25/35 (71%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQ 532 IFVGGL + ++DDE+++ F +FG +L + P K+ Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKR 296 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 141 QDHNSAEAPGRD-DDRKLFVGGLSWETTDKELRDHFGAY 254 Q+ A A D ++ +FVGGL TD EL+ FG + Sbjct: 245 QNTQGANAGDNDPNNTTIFVGGLDANVTDDELKSIFGQF 283 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/34 (47%), Positives = 25/34 (73%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 IFVGGL S ++D++++ FSEFG I+ + P+ K Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGK 341 Score = 30.7 bits (66), Expect = 0.95 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 254 REIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 REI S+ V + + G S G+ F+ F++ + DKV+ Sbjct: 129 REIVSLKVIRNKHNGSSEGYGFVEFESHDVADKVL 163 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +++ V D NTGRS+G+ F+ F K M Sbjct: 226 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 39.5 bits (88), Expect = 0.002 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQ 532 +FVGGL + ++DD ++N FS++G I+ + P K+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKR 297 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 39.5 bits (88), Expect = 0.002 Identities = 14/35 (40%), Positives = 25/35 (71%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQ 532 +FVGGL + ++DD ++N FS++G I+ + P K+ Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYGEIVHVKIPAGKR 297 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/46 (36%), Positives = 29/46 (63%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 66 YDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 111 Score = 35.9 bits (79), Expect = 0.025 Identities = 13/28 (46%), Positives = 22/28 (78%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGGL+S +++ E + +F++FG I + Sbjct: 34 KIFVGGLASSVTEAEFKKYFAQFGMITD 61 Score = 34.7 bits (76), Expect = 0.058 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 I + V D T R RGF FI + + E++DKV+ H +N Sbjct: 59 ITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELN 99 Score = 31.5 bits (68), Expect = 0.54 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 162 APGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 +PG + +K+FVGGL+ T+ E + +F + Sbjct: 26 SPGPSNSKKIFVGGLASSVTEAEFKKYFAQF 56 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 +IFVGGLS E++D ++ FS FG IL+ + L + + R Sbjct: 8 RIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSR 48 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 657 L ++ ++ + +GF FITF + +++ ++ R G + + V RA PK Sbjct: 34 LDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDK 352 +F +I + + +TGRSRGF FI F ++D+ Sbjct: 26 AFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDE 63 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 ++FVGGLS E TD++L F + Sbjct: 8 RIFVGGLSPEVTDRDLERAFSRF 30 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E DE+R +F +FG ILE Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILE 45 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 F EI + TD NTG+S+G+ F+ F+ +S + +A Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVA 76 Score = 31.9 bits (69), Expect = 0.41 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET E+R +F Sbjct: 18 KVFVGGLAWETPTDEMRRYF 37 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGPGGIG 681 DK + KG+ F+TF + P I G++ + A+ P+P P G G Sbjct: 51 DKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPPRGRG 106 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E DE+R +F +FG ILE Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFGEILE 45 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 F EI + TD NTG+S+G+ F+ F+ +S + +A Sbjct: 37 FEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVA 76 Score = 31.9 bits (69), Expect = 0.41 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET E+R +F Sbjct: 18 KVFVGGLAWETPTDEMRRYF 37 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKPDGPGGIG 681 DK + KG+ F+TF + P I G++ + A+ P+P P G G Sbjct: 51 DKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRPSPPRGRG 106 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 657 D N+ +GF F+T++SE V ++++ + K V+VKRA PK Sbjct: 154 DGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPK 198 Score = 36.7 bits (81), Expect = 0.014 Identities = 12/28 (42%), Positives = 22/28 (78%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGG++ E S++ ++ +FS +G +LE Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYGAVLE 34 Score = 35.1 bits (77), Expect = 0.044 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +2 Query: 416 RHGKIFVGGLSSEISDDEIRNFFSEFG 496 R KIFVGGLSS +++E +++F FG Sbjct: 118 RTKKIFVGGLSSNTTEEEFKSYFERFG 144 Score = 31.1 bits (67), Expect = 0.72 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +3 Query: 174 DDDR-KLFVGGLSWETTDKELRDHFGAY 254 D DR KLFVGG++ ET+++ L+ +F Y Sbjct: 2 DYDRYKLFVGGIAKETSEEALKQYFSRY 29 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/21 (52%), Positives = 17/21 (80%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHF 245 +K+FVGGLS TT++E + +F Sbjct: 120 KKIFVGGLSSNTTEEEFKSYF 140 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/34 (44%), Positives = 25/34 (73%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 IFVGGL S ++D++++ F+EFG I+ + P+ K Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGK 339 Score = 33.1 bits (72), Expect = 0.18 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 14/93 (15%) Frame = +2 Query: 254 REIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT----------INNXXXXXX 403 REI S+ V + N G S G+ F+ F++ + DKV+ T +N Sbjct: 127 REIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTG 186 Query: 404 XXXXRHG----KIFVGGLSSEISDDEIRNFFSE 490 + IFVG LS ++SD+ + FSE Sbjct: 187 EKRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +++ V D NTGRS+G+ F+ F K M Sbjct: 224 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRD---HFGAYVK*RVLM*RQ 284 KLF+GGLSW T D LRD HFG V +V++ R+ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRE 71 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+F+GGLS D +R+ F+ FG +++ + + ++ + R Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSR 76 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRD---HFGAYVK*RVLM*RQ 284 KLF+GGLSW T D LRD HFG V +V++ R+ Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRE 71 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+F+GGLS D +R+ F+ FG +++ + + ++ + R Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSR 76 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 36.3 bits (80), Expect = 0.019 Identities = 19/86 (22%), Positives = 36/86 (41%) Frame = +2 Query: 251 IREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRHGKI 430 I EI + + D ++G S+G+AF+ FK + K + ++ Sbjct: 139 IGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRL 198 Query: 431 FVGGLSSEISDDEIRNFFSEFGTILE 508 F+G + ++DE R + G +E Sbjct: 199 FIGNIPKNWTEDEFRKVIEDVGPGVE 224 Score = 31.5 bits (68), Expect = 0.54 Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +2 Query: 419 HG-KIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 HG ++F+GGL ++ ++++R+ E G I E R Sbjct: 114 HGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVR 146 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +2 Query: 260 IESINVKTDP-NTGRSRGFAFIVF 328 +E+I + DP NT R+RGFAF+++ Sbjct: 223 VENIELIKDPTNTTRNRGFAFVLY 246 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 36.3 bits (80), Expect = 0.019 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGGL+WET + LR HF Y Sbjct: 25 KVFVGGLAWETQSETLRQHFEQY 47 Score = 34.3 bits (75), Expect = 0.077 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 EI V D NTGRS+G+ F+ F+ PE+ + A Sbjct: 49 EILEAVVIADKNTGRSKGYGFVTFRDPEAARRACA 83 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + +R F ++G ILE Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYGEILE 52 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 35.9 bits (79), Expect = 0.025 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 IFVGG+ ++ D+++R FS+FG ++ + P+ K Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGK 356 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVF 328 ++S V D NTGRS+G+ F+ F Sbjct: 229 VKSAKVVIDSNTGRSKGYGFVRF 251 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 35.9 bits (79), Expect = 0.025 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGGL+WET + LR HF Y Sbjct: 25 KVFVGGLAWETQSETLRRHFDQY 47 Score = 34.7 bits (76), Expect = 0.058 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPES 343 V TD NTGRS+G+ F+ F+ PE+ Sbjct: 55 VITDKNTGRSKGYGFVTFRDPEA 77 Score = 33.1 bits (72), Expect = 0.18 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + +R F ++G ILE Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYGDILE 52 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 35.5 bits (78), Expect = 0.033 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGGL+ E D +R +F +FG I+E Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFGEIVE 50 Score = 34.7 bits (76), Expect = 0.058 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPES 343 F EI V TD NTGRS+G+ F+ FK E+ Sbjct: 42 FEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET +R +F Sbjct: 23 KIFVGGLAWETQRDTMRRYF 42 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 35.5 bits (78), Expect = 0.033 Identities = 18/63 (28%), Positives = 30/63 (47%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXR 418 +F S EIE +V D +TGR +G+ F++FK + + + E + N + Sbjct: 427 AFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEK 486 Query: 419 HGK 427 GK Sbjct: 487 PGK 489 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 159 EAPGRD-DDRKLFVGGLSWETTDKELRDHFGAY 254 E+ RD R +FV G W+TT + L+ F +Y Sbjct: 399 ESADRDIAQRNIFVRGFGWDTTQENLKTAFESY 431 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 35.5 bits (78), Expect = 0.033 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 681 D+ + +GF F+TF S + ++ ++ + + G+ + V AT + G GG G Sbjct: 68 DRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATERGSGFGGRG 120 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +F E+ + D TGRSRGFAF+ F + E M Sbjct: 53 AFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAM 92 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 KIFVGG+S + +R FS++G +++ + + ++ + R Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSR 75 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGG+S+ T + LR+ F Y Sbjct: 35 KIFVGGISYSTDEFGLREAFSKY 57 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 35.5 bits (78), Expect = 0.033 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 8/89 (8%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNXXXXXXXXXX 415 + +N+ + T RG F+ E DKV+ + G + Sbjct: 38 VNEVNIIKEKTTRAPRGCCFLTCPTREDADKVINSFHNKKTLPGASSPLQVKYADGELER 97 Query: 416 RHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 K+FVG L +S+ E+++ FSE+GTI Sbjct: 98 LEHKLFVGMLPKNVSETEVQSLFSEYGTI 126 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 35.1 bits (77), Expect = 0.044 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHFGAY 254 D + + F+GGL+W T+D+ LRD F Y Sbjct: 4 DPEYRCFIGGLAWTTSDRGLRDAFEKY 30 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 V D +GRSRGF FI F +++D+ +AA Sbjct: 38 VVLDKFSGRSRGFGFITFDEKKAMDEAIAA 67 Score = 31.1 bits (67), Expect = 0.72 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPG 672 DK + +GF FITF+ ++ +++ + + G+ + V +A P G G Sbjct: 41 DKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQGGAG 91 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 34.7 bits (76), Expect = 0.058 Identities = 12/34 (35%), Positives = 25/34 (73%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 IFVGGL ++++++++ FS+FG ++ + P+ K Sbjct: 329 IFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGK 362 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVF 328 ++ V D NTGRS+G+ F+ F Sbjct: 240 VKGAKVVIDSNTGRSKGYGFVRF 262 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 34.7 bits (76), Expect = 0.058 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E +RN+F +FG I+E Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDIVE 35 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET LR++F Sbjct: 8 KVFVGGLAWETHKVSLRNYF 27 Score = 31.1 bits (67), Expect = 0.72 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDK 352 +E++ V TD ++GRS+G+ F+ F PE+ K Sbjct: 34 VEAV-VITDKSSGRSKGYGFVTFCDPEAAQK 63 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 34.7 bits (76), Expect = 0.058 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E +RN+F +FG I+E Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFGDIVE 35 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET LR++F Sbjct: 8 KVFVGGLAWETHKVSLRNYF 27 Score = 31.1 bits (67), Expect = 0.72 Identities = 13/31 (41%), Positives = 22/31 (70%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDK 352 +E++ V TD ++GRS+G+ F+ F PE+ K Sbjct: 34 VEAV-VITDKSSGRSKGYGFVTFCDPEAAQK 63 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 34.7 bits (76), Expect = 0.058 Identities = 31/102 (30%), Positives = 44/102 (43%), Gaps = 14/102 (13%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPES----IDKV--MAAGEHTI------- 379 +F S I S V D TGRS+G+ F+ F+ ES IDK+ M + + Sbjct: 155 TFSSFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIR 213 Query: 380 -NNXXXXXXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 R ++V L EI +DE+R F +FG I Sbjct: 214 RQERARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFGVI 255 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 34.3 bits (75), Expect = 0.077 Identities = 11/41 (26%), Positives = 27/41 (65%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+F+GG++ + +D +R F+++G +++ R L ++ + R Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSR 81 Score = 32.7 bits (71), Expect = 0.23 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 +F E+ V D TGRSRGF F+ F + E+ + A Sbjct: 59 AFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGGIG 681 D+ + +GF F+TF S + + ++ R + G+ V V A + G GG G Sbjct: 74 DRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYANDRTSG-GGFG 126 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGGIG 681 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG G Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGGGG 93 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 + FVGGL+W T D++L+ F + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQF 29 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 +F ++ + D +GRSRGF F+ FK Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGGIG 681 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG G Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGGGG 93 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 + FVGGL+W T D++L+ F + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQF 29 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 +F ++ + D +GRSRGF F+ FK Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +F S E+ V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 99 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELRDHFGAY 254 N+L+G G S + G R KLFVGGLSW T D L+ F ++ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAFTSF 58 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGLS D ++ F+ FG + E Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTE 63 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 33.9 bits (74), Expect = 0.10 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +F S E+ V D TGRSRGF F+ F +S + + Sbjct: 54 AFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 33.5 bits (73), Expect = 0.13 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +3 Query: 99 NQLNGNAENGGGDSQDHNSAEAPG--RDDDRKLFVGGLSWETTDKELRDHFGAY 254 N+L+G G S + G R KLFVGGLSW T D L+ F ++ Sbjct: 5 NKLSGILRQGVSQSSNGPVTSMLGSLRYMSSKLFVGGLSWGTDDSSLKQAFTSF 58 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGLS D ++ F+ FG + E Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFGEVTE 63 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 33.9 bits (74), Expect = 0.10 Identities = 19/50 (38%), Positives = 33/50 (66%), Gaps = 3/50 (6%) Frame = +3 Query: 135 DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELR---DHFGAYVK*RVLM 275 DS+D + +E+P +KLF+ GLS+ T++K LR + FG V+ +++M Sbjct: 267 DSRDQDDSESPPVKT-KKLFITGLSFYTSEKTLRAAFEGFGELVEVKIIM 315 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+F+GGLS + + +++ FS FG + E R K + R Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSR 82 Score = 32.7 bits (71), Expect = 0.23 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 KLF+GGLSW ++ L+D F ++ Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSF 64 Score = 30.7 bits (66), Expect = 0.95 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVF 328 +F S E+ + + D +GRSRGF F+ F Sbjct: 60 AFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.9 bits (74), Expect = 0.10 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 180 DRKLFVGGLSWETTDKELRDHFGAYVK 260 + ++FVGGLSW+ T+++L F Y K Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGK 37 Score = 31.5 bits (68), Expect = 0.54 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 544 KGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPKPDG 666 +GF FITF + +D +K R +G K + V +A PK G Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVGG 94 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 +IFVGGLS ++++ ++ + F +G I E Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITE 40 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.9 bits (74), Expect = 0.10 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 Query: 180 DRKLFVGGLSWETTDKELRDHFGAYVK 260 + ++FVGGLSW+ T+++L F Y K Sbjct: 11 ESRIFVGGLSWDVTERQLESTFDRYGK 37 Score = 31.5 bits (68), Expect = 0.54 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 544 KGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPKPDG 666 +GF FITF + +D +K R +G K + V +A PK G Sbjct: 53 RGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVGG 94 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 +IFVGGLS ++++ ++ + F +G I E Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYGKITE 40 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTI 502 K+FVG L +S+ E+++ FSE+GTI Sbjct: 110 KLFVGMLPKNVSETEVQSLFSEYGTI 135 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 143 VRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 F EIE + D TGR +GF V+K+ ES + + Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRAL 303 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 KI+V + +E+ ++ FFS+FG I E L K Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDK 280 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 F EIE + D TGR +GF V+K+ ES + + Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRAL 303 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 KI+V + +E+ ++ FFS+FG I E L K Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDK 280 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 660 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 F EIE + D TGR +GF V+K+ ES + + Sbjct: 265 FSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRAL 303 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 KI+V + +E+ ++ FFS+FG I E L K Sbjct: 246 KIYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDK 280 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPL 523 K++VGG+ + ++DEIR++F G I++ C + Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKM 194 Score = 28.3 bits (60), Expect = 5.0 Identities = 9/20 (45%), Positives = 17/20 (85%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 KL+VGG+ +++T+ E+R +F Sbjct: 162 KLYVGGIPYQSTEDEIRSYF 181 Score = 28.3 bits (60), Expect = 5.0 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHF 245 D ++++G L+W+TT++++R F Sbjct: 259 DGYNRVYIGNLAWDTTERDIRKLF 282 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.5 bits (73), Expect = 0.13 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 290 NTGRSRGFAFIVFKAPESIDKVMA 361 NTGRSRGF FI F++ E++ +A Sbjct: 255 NTGRSRGFGFISFESAENVQSALA 278 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +2 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 G+++VG L I+ E+ F E GT+++ + K + R Sbjct: 116 GRLYVGNLPYTITSSELSQIFGEAGTVVDVQIVYDKVTDRSR 157 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHFG 248 D K++ G L W T + L+D FG Sbjct: 216 DSPHKVYAGNLGWNLTSQGLKDAFG 240 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 660 +D+ + KGF F+T++S Q V + +K+ + G+++ V A +P Sbjct: 237 YDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARP 284 Score = 30.7 bits (66), Expect = 0.95 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE 370 F S +E + V D TGRSRGF F+ S+ +V AA + Sbjct: 111 FESAGNVEMVEVIYDKITGRSRGFGFVTM---SSVSEVEAAAQ 150 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 675 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEAQSRGSGGGG 91 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 + FVGGL+W T D++L+ F + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQF 29 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 +F ++ + D +GRSRGF F+ FK Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 33.1 bits (72), Expect = 0.18 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 14/93 (15%) Frame = +2 Query: 254 REIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT----------INNXXXXXX 403 REI S+ V + N G S G+ F+ F++ + DKV+ T +N Sbjct: 127 REIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTG 186 Query: 404 XXXXRHG----KIFVGGLSSEISDDEIRNFFSE 490 + IFVG LS ++SD+ + FSE Sbjct: 187 EKRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +++ V D NTGRS+G+ F+ F K M Sbjct: 224 VKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 32.7 bits (71), Expect = 0.23 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 675 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 42 DRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSRGSGGGG 93 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHFGAY 254 D + + FVGGL+W T D+ L F Y Sbjct: 5 DVEYRCFVGGLAWATDDRALETAFAQY 31 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 +F ++ + D TGRSRGF F+ FK Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFK 57 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 32.7 bits (71), Expect = 0.23 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKPDGPGG 675 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A + G GG Sbjct: 42 DRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSRGSGGGG 93 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHFGAY 254 D + + FVGGL+W T D+ L F Y Sbjct: 5 DVEYRCFVGGLAWATDDRALETAFAQY 31 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 +F ++ + D TGRSRGF F+ FK Sbjct: 27 AFAQYGDVIDSKIINDRETGRSRGFGFVTFK 57 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 32.3 bits (70), Expect = 0.31 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 K+FVGGL+W+T + + DHF Y Sbjct: 18 KVFVGGLAWDTHKEAMYDHFIKY 40 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 32.3 bits (70), Expect = 0.31 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 +F S ++ V TD ++GRS+GF F+ + E +K A Sbjct: 53 AFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 31.9 bits (69), Expect = 0.41 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQ 532 IFVG + +++D++++ F +FG ++ + P K+ Sbjct: 280 IFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKR 314 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 471 VQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 31.9 bits (69), Expect = 0.41 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 672 DK + KGF F+ F++ + + LK PK+ I + + A+ P G Sbjct: 138 DKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASG 187 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINN 385 EIE V D TG+++GF F++FK + + + + I N Sbjct: 129 EIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILN 171 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 159 EAPGRD-DDRKLFVGGLSWETTDKELRDHFGAY 254 EA RD RK+FV GL WETT + L F Y Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETLVGVFEGY 127 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 31.9 bits (69), Expect = 0.41 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPG 672 DK + KGF F+ F++ + + LK PK+ I + + A+ P G Sbjct: 138 DKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGPAASG 187 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINN 385 EIE V D TG+++GF F++FK + + + + I N Sbjct: 129 EIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILN 171 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 159 EAPGRD-DDRKLFVGGLSWETTDKELRDHFGAY 254 EA RD RK+FV GL WETT + L F Y Sbjct: 95 EAADRDVTHRKIFVYGLPWETTRETLVGVFEGY 127 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 31.5 bits (68), Expect = 0.54 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPES 343 F EI V TD +GRS+G+ F+ F+ E+ Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 31.5 bits (68), Expect = 0.54 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPES 343 F EI V TD +GRS+G+ F+ F+ E+ Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 31.9 bits (69), Expect = 0.41 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVGGL+ E + ++ F +FG ILE Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFGEILE 41 Score = 31.5 bits (68), Expect = 0.54 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVGGL+WET + ++ HF Sbjct: 14 KVFVGGLAWETHKETMKKHF 33 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPES 343 F EI V TD +GRS+G+ F+ F+ E+ Sbjct: 33 FEQFGEILEAVVITDKASGRSKGYGFVTFREAEA 66 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 31.5 bits (68), Expect = 0.54 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTIN 382 EI V D T RS+GF F+ F+ ES + HTI+ Sbjct: 34 EIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTID 75 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 648 D + KGF F+TF + + P TI G+ V+ K A Sbjct: 43 DGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 416 RHGKIFVGGLSSEISDDEIRNFFSEFGTI 502 + GKIFVG L + I E FF +FG I Sbjct: 163 QEGKIFVGNLPTWIKKPEFEEFFRQFGPI 191 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 31.5 bits (68), Expect = 0.54 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVG L+ + D++R +F +FG +++ Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFGQVVD 40 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 K+FVG L+W TT +LR +F Sbjct: 13 KIFVGNLTWRTTADDLRRYF 32 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 31.5 bits (68), Expect = 0.54 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 12/98 (12%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPES----IDKV--MAAGEHTI------N 382 +F + I S V DP+ G+S+G+ F+ + E+ IDK+ M + + + Sbjct: 152 TFSAFGPILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVH 210 Query: 383 NXXXXXXXXXXRHGKIFVGGLSSEISDDEIRNFFSEFG 496 + ++V LS +SD+E+ F EFG Sbjct: 211 KLQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFG 248 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 ++V L ++DD++R F+ FGTI Sbjct: 329 LYVKNLDESVTDDKLREHFAPFGTI 353 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 31.5 bits (68), Expect = 0.54 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 K++VG L D +RN FS+FGTI+ R Sbjct: 213 KVYVGNLPWFTQPDGLRNHFSKFGTIVSTR 242 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDH---FGAYVK*RVL 272 + K++VG L W T LR+H FG V RVL Sbjct: 209 ESQHKVYVGNLPWFTQPDGLRNHFSKFGTIVSTRVL 244 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 I S V D TGR+R FAF+ F + E D ++ Sbjct: 238 IVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 271 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 31.1 bits (67), Expect = 0.72 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 +F S + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 50 AFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 K+++GGLS + +++ FS F + E R K + R Sbjct: 32 KLYIGGLSPGTDEHSLKDAFSSFNGVTEARVMTNKVTGRSR 72 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +1 Query: 520 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 675 F +T+ G C F+ FE V + +K +GG++V ++ P P G G Sbjct: 289 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRG 342 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 31.1 bits (67), Expect = 0.72 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = +1 Query: 520 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGG 675 F +T+ G C F+ FE V + +K +GG++V ++ P P G G Sbjct: 348 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNPAGVRG 401 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 31.1 bits (67), Expect = 0.72 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFK 331 EI +V D +TGR++GF F++FK Sbjct: 188 EITECSVVMDKDTGRAKGFGFVLFK 212 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 159 EAPGRDDD-RKLFVGGLSWETTDKELRDHFGAY 254 E+ RD R +FV GL W+TT + L+ F Y Sbjct: 154 ESADRDSSQRNIFVRGLGWDTTHENLKAAFEVY 186 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 666 DK + KGF F+ F++ + LK P++ + + V A P G Sbjct: 197 DKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARPFNSG 244 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 31.1 bits (67), Expect = 0.72 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 681 D+ + KGF F+TF+ E D ++T + G+E+D + T + G G G Sbjct: 78 DRETGRSKGFRFVTFKDE----DSMRTAIDRMNGQELDGRNITAQARGSGTRG 126 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESI 346 E+ + D TGRS+GF F+ FK +S+ Sbjct: 69 EVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 30.7 bits (66), Expect = 0.95 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +3 Query: 108 NGNAENGGGDSQDHNSAEAPGRD--DDRKLFVGGLSWETTDKELRDHFGAYVK 260 +G+A GD + ++A D D +LFV L + T++EL +HF + K Sbjct: 234 DGDAMEVEGDGKVAQESKAVSDDVLDTGRLFVRNLPYTATEEELMEHFSTFGK 286 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 30.7 bits (66), Expect = 0.95 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPES 343 EI +N+ D TG+S+GFAF+ ++ S Sbjct: 61 EIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 30.7 bits (66), Expect = 0.95 Identities = 16/85 (18%), Positives = 35/85 (41%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F + E+ + + +P T +S+G AF+ F E + + + + N + Sbjct: 234 FGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGVTASQDN 293 Query: 422 GKIFVGGLSSEISDDEIRNFFSEFG 496 +FVG + + + +R +G Sbjct: 294 DTLFVGNICKIWTPEALREKLKHYG 318 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 30.7 bits (66), Expect = 0.95 Identities = 24/96 (25%), Positives = 39/96 (40%), Gaps = 8/96 (8%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXR- 418 F + + ++ V D T RS G+A++ F PE + M + + R Sbjct: 65 FNQVAPVHNLRVCRDL-THRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRD 123 Query: 419 -------HGKIFVGGLSSEISDDEIRNFFSEFGTIL 505 G +F+ L + I + + FS FGTIL Sbjct: 124 PSTRLSGKGNVFIKNLDASIDNKALYETFSSFGTIL 159 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 30.7 bits (66), Expect = 0.95 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 248 SIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 S + N+ D TG S+G+AF V++ P D AA Sbjct: 397 SFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 102 QLNGNAENGGGDSQDHN---SAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 ++ AE G SQD + SA D R ++VG + + T +E++ HF Sbjct: 73 EMQAKAEKDMGASQDPSGGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHF 123 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 367 IE++ V DP+ +G A+++FK E+ + V+ G Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKG 348 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 + FVGGL+ +D++++ FS+FG +++ Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFGDVID 34 Score = 28.7 bits (61), Expect = 3.8 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHFGAY 254 + FVGGL+W T D++L+ F + Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQF 29 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 +F ++ + D +GRSRGF F+ FK Sbjct: 25 TFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGG 624 D+ + +GF F+TF+ E+ + D ++ + GG Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGSGGG 73 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVG + +++EIR +F + G +LE Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLE 148 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTI 502 K+FVG L+ + ++ E+ F +FG + Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHV 237 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 K+FVG + +++EIR +F + G +LE Sbjct: 121 KLFVGSVPRTATEEEIRPYFEQHGNVLE 148 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTI 502 K+FVG L+ + ++ E+ F +FG + Sbjct: 212 KLFVGSLNKQATEKEVEEIFLQFGHV 237 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWR 514 +F G LS +I+ +I NFF E G +++ R Sbjct: 386 LFAGNLSYQIARSDIENFFKEAGEVVDVR 414 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFI 322 E+ ++V TD TG SRGFA+I Sbjct: 508 EVTRVHVPTDRETGASRGFAYI 529 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 132 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G + + + E+P R L+VGGL+ ++++RD F A+ Sbjct: 211 GKAGEMGTLESPEDQSIRTLYVGGLNSRVLEQDIRDQFYAH 251 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 K++V GLS ++D +R+ F +FG ++ + K Sbjct: 78 KLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDK 112 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +3 Query: 186 KLFVGGLSWETTDKELRDHF 245 KL+V GLS+ TT+ LRD F Sbjct: 78 KLYVSGLSFRTTEDTLRDTF 97 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKE 544 +FV G S +S+ ++ FSEFG + + + +RT++ Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKI-IANERTRQ 97 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKE 544 +FV G S +S+ ++ FSEFG + + + +RT++ Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKI-IANERTRQ 116 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 159 EAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 E P + + L+VGGL+ ++++ DHF AY Sbjct: 217 EPPEDESIKTLYVGGLNSRIFEQDIHDHFYAY 248 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESID 349 F S +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 660 +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 282 YDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 329 Score = 27.9 bits (59), Expect = 6.7 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Frame = +3 Query: 111 GNAENGGG------DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF---GAYVK* 263 G+ +GGG S S G +L+VG LSW D L + F G V+ Sbjct: 219 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGKVVEA 278 Query: 264 RVL 272 RV+ Sbjct: 279 RVI 281 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 +++VG LS + D + N F+E G ++E R Sbjct: 250 RLYVGNLSWGVDDMALENLFNEQGKVVEAR 279 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESID 349 F S +E + V D TGRSRGF F+ ++ Sbjct: 119 FESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 660 +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 290 YDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 337 Score = 27.9 bits (59), Expect = 6.7 Identities = 20/63 (31%), Positives = 27/63 (42%), Gaps = 9/63 (14%) Frame = +3 Query: 111 GNAENGGG------DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF---GAYVK* 263 G+ +GGG S S G +L+VG LSW D L + F G V+ Sbjct: 227 GSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNEQGKVVEA 286 Query: 264 RVL 272 RV+ Sbjct: 287 RVI 289 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 +++VG LS + D + N F+E G ++E R Sbjct: 258 RLYVGNLSWGVDDMALENLFNEQGKVVEAR 287 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 F + ++E + D TG+SRGFA V+K E +A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALA 226 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 666 FDK + +GF +++ + L P + I GK ++ K A G Sbjct: 200 FDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 RKLF+ GL+ +TT + LR F +Y Sbjct: 75 RKLFIRGLAADTTTEGLRSLFSSY 98 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 F + ++E + D TG+SRGFA V+K E +A Sbjct: 187 FMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALA 226 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/49 (26%), Positives = 22/49 (44%) Frame = +1 Query: 520 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDG 666 FDK + +GF +++ + L P + I GK ++ K A G Sbjct: 200 FDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLAVDGKKG 248 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 RKLF+ GL+ +TT + LR F +Y Sbjct: 75 RKLFIRGLAADTTTEGLRSLFSSY 98 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWR 514 ++VGG+ +S D++ FS+FG I ++R Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKIEDFR 280 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +3 Query: 108 NGNAENGG--GDSQDHNSAEAPGRDDDR 185 +GN E G GD D++ + PG DDD+ Sbjct: 962 DGNHERGSESGDGDDYDDGDGPGSDDDK 989 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFKAPESID 349 + DP+TG SRGF FI + + E+ D Sbjct: 144 IMRDPDTGNSRGFGFISYDSFEASD 168 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 SF + V D TGRSRGF F+ F+ Sbjct: 167 SFSAFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/41 (29%), Positives = 25/41 (60%) Frame = +3 Query: 132 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAY 254 G + + + E+P + + L+VGGL+ ++++RD F A+ Sbjct: 211 GKAGEMGTLESPDDESIKTLYVGGLNSRILEQDIRDQFYAH 251 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 29.5 bits (63), Expect = 2.2 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 ++ S V P T +S GF F+ F + E ++ + A Sbjct: 202 KVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVA 237 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 +E + V D +GRSR F F K+ E + V+ Sbjct: 102 VEKVQVMYDKYSGRSRRFGFATMKSVEDANAVV 134 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 66 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 185 NDN + +N N N NGGG ++ S P R+ DR Sbjct: 119 NDNNGNNNNGNNNDNNNQNNGGG--SNNRSPPPPSRNSDR 156 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 63 NNDNFAQDITTDNQLNGNAENGGGDSQDHNS 155 NN N D +N N N +N G+++D+N+ Sbjct: 76 NNGNNNNDNNNNNNGNNNNDNNNGNNKDNNN 106 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 + S+ V D GRSRGF F+ F PE+ K M Sbjct: 228 VSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 29.5 bits (63), Expect = 2.2 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 EIE + D TGR +GFA V+++ ES K + Sbjct: 252 EIEEGPLGLDKATGRPKGFALFVYRSLESAKKAL 285 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTK 529 KI+V +S++I ++ FFS FG I E L K Sbjct: 228 KIYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDK 262 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 183 RKLFVGGLSWETTDKELRDHFGAY 254 RK+FV GL W+T L D F Y Sbjct: 128 RKIFVHGLGWDTKADSLIDAFKQY 151 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 ++V L ++D+++R F+EFGTI Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGTI 354 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/96 (20%), Positives = 37/96 (38%), Gaps = 8/96 (8%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNXXXXXXXXXXRH 421 F + ++ S+ V D T S G+ ++ + + +K M ++ N R Sbjct: 66 FTEVCQVVSVRVCRDAATNTSLGYGYVNYSNTDDAEKAMQKLNYSYLNGKMIRITYSSRD 125 Query: 422 --------GKIFVGGLSSEISDDEIRNFFSEFGTIL 505 G +FV L + + + FS GTI+ Sbjct: 126 SSARRSGVGNLFVKNLDKSVDNKTLHEAFSGCGTIV 161 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = +2 Query: 431 FVGGLSSEISDDEIRNFFSEFGTIL 505 +VG L S+ +++++N FS+FG ++ Sbjct: 11 YVGNLESDTEENDLKNAFSQFGDVI 35 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +1 Query: 523 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKE--VDVKRAT 651 D T + KGF F FES E ++ + +RTI G+E V+V +AT Sbjct: 237 DPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNVNQAT 282 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 +++VG LS +DD +R FS +G +++ Sbjct: 4 RVYVGNLSPTTTDDMLREAFSGYGNVVD 31 >At2g47390.1 68415.m05915 expressed protein Length = 961 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 108 NGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRD 239 +G AE+GGG S SA A +DD G + E+RD Sbjct: 78 SGGAEDGGGTSNGSLSASATATEDDELAI--GTGYRLPPPEIRD 119 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +1 Query: 502 LRMEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEV 633 L++++ DK + + KGF ++TF S E+ LL+ + + G+ V Sbjct: 48 LKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVF 328 F S EI++++V D +TG S+G A++ F Sbjct: 425 FSSCGEIKNVSVPIDRDTGNSKGIAYLEF 453 >At5g43420.1 68418.m05309 zinc finger (C3HC4-type RING finger) family protein low similarity to RING-H2 zinc finger protein ATL4 [Arabidopsis thaliana] GI:4928399; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 375 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -3 Query: 680 PMPPGPSGFGVARFTSTSFP--PIVLLGVLSKSFTTCS 573 P PP P F A T TSFP + ++G+L+ +F S Sbjct: 16 PPPPPPPIFHRASSTGTSFPILAVAVIGILATAFLLVS 53 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 242 FWSIREIESINVKTDPNTGRSRGFAFIVF 328 F + +E + + DP TG+ +GF FI F Sbjct: 285 FEAFGPVELVQLPLDPETGQCKGFGFIQF 313 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +1 Query: 511 EMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 681 ++ D+ ++ KGF F+TF S ++ L++ + + G+ + V A K GG G Sbjct: 64 QIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAKQSLGGGGG 121 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 373 + + V + N+G SRGFAFI F ++ +M EH Sbjct: 324 LHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 28.7 bits (61), Expect = 3.8 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTI 502 +++VG L +S+D++R F FG++ Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGSV 311 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/52 (26%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKPDGPGG 675 D+ +GF F+T++S +V N+ ++ + + G+ + V A G GG Sbjct: 70 DRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPADSGGGGGGG 121 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILE 508 KIFVGGLS + ++ F FG I++ Sbjct: 37 KIFVGGLSPSTDVELLKEAFGSFGKIVD 64 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 523 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 648 D+ + KGF FITFESE LK + + G+ + V+ A Sbjct: 100 DQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETA 142 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 ++ V +D TGRSRGF F+ ++ +AA Sbjct: 232 KVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 +FV G S +S+ ++ FSEFG + Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQV 84 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 +++G + + EI FFS+FGT+ R K+ K + Sbjct: 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSK 101 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 28.3 bits (60), Expect = 5.0 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 ++V L ISD++++ FS FGT+ Sbjct: 134 LYVKNLDPSISDEKLKEIFSPFGTV 158 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 260 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 361 + S V DPN G S+G F+ F PE + M+ Sbjct: 158 VTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS 190 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 428 IFVGGLSSEISDDEIRNFFSEFGTI 502 ++V L+ +DD+++N F E+G I Sbjct: 31 VYVKNLAESTTDDDLKNAFGEYGKI 55 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 239 SFWSIREIESINVKTDPNTGRSRGFAFIVFK 331 SF V D TGRSRGF F+ F+ Sbjct: 163 SFSVFSSCSDARVMWDQKTGRSRGFGFVSFR 193 >At2g33440.1 68415.m04099 splicing factor family protein similar to Splicing factor U2AF 65 kDa subunit (U2 snRNP auxiliary factor large subunit) {Homo sapiens} SP|P26368, {Mus musculus} SP|P26369; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 247 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWR 514 KIF+GG S IS + + S FG + +R Sbjct: 41 KIFIGGFSKAISSEMLMEIVSVFGPLKAYR 70 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 150 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 + AE PG L+V GLS T+++L DHF Sbjct: 38 SDAENPGNS----LYVTGLSHRVTERDLEDHF 65 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 379 ++ +++ DP T SRGF FI K+ ++ + + +H++ Sbjct: 70 KVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSV 110 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 150 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 + AE PG L+V GLS T+++L DHF Sbjct: 68 SDAENPGNS----LYVTGLSHRVTERDLEDHF 95 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 379 ++ +++ DP T SRGF FI K+ ++ + + +H++ Sbjct: 100 KVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSV 140 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +3 Query: 93 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 242 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +3 Query: 93 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 242 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +3 Query: 93 TDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDH 242 T NG GGG + + P R + ++ V GL + ++L+DH Sbjct: 90 TRGSFNGGGR-GGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDH 138 >At5g22830.1 68418.m02669 magnesium transporter CorA-like family protein weak similarity to SP|Q01926 RNA splicing protein MRS2, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF01544: CorA-like Mg2+ transporter protein; supporting cDNA gi|12007446|gb|AF322255.1|AF322255 Length = 459 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 60 ANNDNFAQDITTDNQ-LNGNAENGGGDSQDHNSAEAPGRDDDRKL 191 A + A+D D + LN + ++ G DS + GRDD +K+ Sbjct: 65 AKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKI 109 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 364 ++ V D TGRSRGF F+ + +++ ++A Sbjct: 269 KVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/41 (24%), Positives = 22/41 (53%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTILEWRCPLTKQRTKER 547 +++VG L ++ + + FSE G ++E R ++ + R Sbjct: 245 RVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSR 285 >At3g21100.1 68416.m02667 RNA recognition motif (RRM)-containing protein contains Pfam profile:PF00076 RNA recognition motif Length = 602 Score = 27.9 bits (59), Expect = 6.7 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 449 SEISDDEIRNFFSEFGTILEWRCPLTKQR 535 S +D+++ N+F FG + + R P ++R Sbjct: 328 SSFTDEDVSNYFGNFGPVQDVRIPYQQKR 356 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 ++ + + D TG SRGFAF+ +K + K + Sbjct: 41 KVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAV 74 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 257 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 358 ++ + + D TG SRGFAF+ +K + K + Sbjct: 41 KVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAV 74 >At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein G3BP ras-GTPase-activating protein SH3-domain binding protein, Mus musculus, EMBL:MMU65313 Length = 460 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +1 Query: 535 NQRKGFCF--ITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKPDGPGGIG 681 N+++GFCF + FE+ L+ TIG ++ V+ G G G Sbjct: 329 NKQQGFCFGFVEFETSSGKQSALEASPVTIGDRQAVVEEKKTNSRGGGNNG 379 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 425 KIFVGGLSSEISDDEIRNFFSEFGTIL 505 KI+VGGL + + NFF FG I+ Sbjct: 14 KIYVGGLPWTTRKEGLINFFKRFGEII 40 >At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 552 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 449 SEISDDEIRNFFSEFGTILEWRCPLTKQR 535 S D+++ +FS FGT+ + R P ++R Sbjct: 269 STFKDEDVATYFSLFGTVQDVRIPYQQKR 297 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 132 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 245 G S+ + + + L+V GLS TDK+L HF Sbjct: 55 GRSRSRSRGRSEVENPGTTLYVTGLSTRVTDKDLEAHF 92 >At1g62170.1 68414.m07013 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 GI:9937311 from [Cucurbita maxima]; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 433 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 455 ISDDEIRNFFSEFGTILEWRCPLTKQRTKERASVSSHLN 571 +S D +NFFS +++R + RT+ A SSH N Sbjct: 174 LSKDLFKNFFSAAFAQVDFRSKAEEVRTEVNAWASSHTN 212 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 174 DDDRKLFVGGLSWETTDKELRDHF 245 + + KLFVG LSW T + L F Sbjct: 174 ETEHKLFVGNLSWTVTSESLAGAF 197 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFK 331 V D TGRSRGF F+ F+ Sbjct: 183 VMWDQKTGRSRGFGFVSFR 201 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 275 VKTDPNTGRSRGFAFIVFK 331 V D TGRSRGF F+ F+ Sbjct: 170 VMWDQKTGRSRGFGFVSFR 188 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,597,677 Number of Sequences: 28952 Number of extensions: 328746 Number of successful extensions: 1643 Number of sequences better than 10.0: 151 Number of HSP's better than 10.0 without gapping: 1178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1630 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -