BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00713 (733 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0FEN4 Cluster: Phosphoenolpyruvate carboxylase; n=1; a... 34 4.1 >UniRef50_Q0FEN4 Cluster: Phosphoenolpyruvate carboxylase; n=1; alpha proteobacterium HTCC2255|Rep: Phosphoenolpyruvate carboxylase - alpha proteobacterium HTCC2255 Length = 907 Score = 33.9 bits (74), Expect = 4.1 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 2/93 (2%) Frame = -1 Query: 289 GQVFKHSLTIYNFSMYCIVYLINKESTFRRFNHFTK*IDIIFYRNNKVLCVNKICSRYNR 110 G+VF+ SLT +F + I+ N + + F K +D++ N L +I ++Y R Sbjct: 328 GEVFRKSLTAIDFRLEAIINPENGATPYASCEEFRKDLDLV--DNVLSLAAREISNQYIR 385 Query: 109 IVFALND*SMFLEIGLHSTKQHKDV--HSLSNI 17 + AL+ F + L +Q+ DV ++SNI Sbjct: 386 PIQALHSSCGFRTMSL-DIRQNSDVTTDAISNI 417 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 578,457,505 Number of Sequences: 1657284 Number of extensions: 10212582 Number of successful extensions: 20220 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20208 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59265488880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -