Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00713
         (733 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_02_0008 + 8473198-8475523,8475618-8475967                           28   8.8  

>04_02_0008 + 8473198-8475523,8475618-8475967
          Length = 891

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 5/62 (8%)
 Frame = -1

Query: 271 SLTIYNFSMYCIVYLINKESTFRRFNHFTK*IDIIFY-----RNNKVLCVNKICSRYNRI 107
           ++T+  FS+ CI++ + KEST ++ +++ + +  + Y       N    VNKI S +   
Sbjct: 547 TVTVALFSILCIMFTLRKESTTQQSSNYKETMKRVSYGDILKATNWFSPVNKISSSHTGS 606

Query: 106 VF 101
           V+
Sbjct: 607 VY 608


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,454,359
Number of Sequences: 37544
Number of extensions: 239019
Number of successful extensions: 315
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 312
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 315
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1921741964
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)