BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00713 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45933| Best HMM Match : RVT_1 (HMM E-Value=3.2e-13) 28 6.8 SB_26943| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_45933| Best HMM Match : RVT_1 (HMM E-Value=3.2e-13) Length = 901 Score = 28.3 bits (60), Expect = 6.8 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -1 Query: 274 HSLTIYNFSM---YCIVYLINKESTFRRFNHFTK*IDIIFYRNNKVLCVNKICSRY 116 H+L I + +CI Y+ + R HF + +++ Y N+K LCV I Y Sbjct: 737 HALDISTMDLTDKHCIFYIQELLKSSRPSKHFGR-LEVKAYENDKRLCVVTIIKEY 791 >SB_26943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 70 SLGTCFNRSEQTQCDYTLNIFYLH-ITPYC 156 +L T +N + T C++TLN Y H +T C Sbjct: 5 TLTTMYNHTLTTMCNHTLNTMYNHTLTTMC 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,667,905 Number of Sequences: 59808 Number of extensions: 348500 Number of successful extensions: 679 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -