BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00712 (775 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 27 0.85 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 26 1.5 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 2.0 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 25 2.6 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 6.0 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 26.6 bits (56), Expect = 0.85 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 436 T*DHFVVKVMKT*KSCLEILK 374 T DH VV+ + T K+C+E LK Sbjct: 627 TLDHIVVETIDTAKACIEFLK 647 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 25.8 bits (54), Expect = 1.5 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 667 NPLLFSCGLETGIGRIVNINKRTLHSF 747 NP F CGL+T RI+ N + F Sbjct: 98 NPKAFECGLDTLADRIIGGNYTAIDEF 124 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.4 bits (53), Expect = 2.0 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +3 Query: 411 TLTTKWSQVIWSNRLPSLRQ*SSMLRP--HEVFLGNTDGGVP 530 +L +S V+WS +PS+R +S P H+ + D P Sbjct: 490 SLLDPYSAVVWSGVVPSIRSAASEWNPRAHQPMIALLDAWAP 531 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 25.0 bits (52), Expect = 2.6 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 515 RWWGPASFHGSVFGRDLVLQG 577 R + P S +G G+DLVLQG Sbjct: 384 RMYPPTSGNGRCTGKDLVLQG 404 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.8 bits (49), Expect = 6.0 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 146 LSVIFVN*KPKTLNYLTDICRRMHTELVWTNTKRSLEVVIKL 271 L ++F N + ++ D+ +LVW + R L VV K+ Sbjct: 747 LGILFTNNVREAMSLNWDLLIHHFRQLVWLHRVRDLNVVQKV 788 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,080 Number of Sequences: 2352 Number of extensions: 14442 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -