BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00709 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 26 0.37 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 26 0.37 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 26 0.37 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 3.4 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.9 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 25.8 bits (54), Expect = 0.37 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 222 PQGAGSPFILAGNFANVIRYFPTQALNFAFKD 317 P GS F+L G+ A+ + F Q +N F+D Sbjct: 58 PYHVGSKFLLIGDAAHAMVPFYGQGMNAGFED 89 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 25.8 bits (54), Expect = 0.37 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 222 PQGAGSPFILAGNFANVIRYFPTQALNFAFKD 317 P GS F+L G+ A+ + F Q +N F+D Sbjct: 291 PYHVGSKFLLIGDAAHAMVPFYGQGMNAGFED 322 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 25.8 bits (54), Expect = 0.37 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 222 PQGAGSPFILAGNFANVIRYFPTQALNFAFKD 317 P GS F+L G+ A+ + F Q +N F+D Sbjct: 291 PYHVGSKFLLIGDAAHAMVPFYGQGMNAGFED 322 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 183 PALQGYRRCLRPYP 224 P + YR C RPYP Sbjct: 251 PYVPFYRYCYRPYP 264 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +1 Query: 565 FRCVRARYHHLPC 603 + C R HH+PC Sbjct: 935 YMCEGERKHHMPC 947 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,526 Number of Sequences: 336 Number of extensions: 2719 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -