BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00706 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19257| Best HMM Match : No HMM Matches (HMM E-Value=.) 271 3e-73 SB_42692| Best HMM Match : Ribosomal_L2_C (HMM E-Value=4.9e-05) 201 3e-52 SB_43058| Best HMM Match : Ribosomal_L2_C (HMM E-Value=8.26766e-44) 41 7e-04 SB_39055| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.77 SB_16681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_20840| Best HMM Match : Rota_NS26 (HMM E-Value=4.2) 29 2.3 SB_6614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 SB_59547| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_55367| Best HMM Match : Granulin (HMM E-Value=0.00023) 27 9.4 SB_22791| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_19257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 271 bits (665), Expect = 3e-73 Identities = 125/164 (76%), Positives = 142/164 (86%), Gaps = 1/164 (0%) Frame = +2 Query: 23 MGRVIRAQRKGAGSVFVSHTKKRKGAPKLRSLDYAERHGYIKGVVKDIIHDPGRGAPLAV 202 MGRVIR QRKGAGS+F SHTK RKGA LR DYAERHGYIKGVVK+IIHDPGRGAPLAV Sbjct: 1 MGRVIRGQRKGAGSIFTSHTKHRKGAANLRVHDYAERHGYIKGVVKEIIHDPGRGAPLAV 60 Query: 203 VHFRDPYKFKTRKELFIVPK-LYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKM 379 V FRDPY++K RKELF+ + +YTGQF+YCGKKA L++GN +PVG MPEGTI+ ++EEK Sbjct: 61 VVFRDPYRYKLRKELFVATEGMYTGQFIYCGKKAALQIGNCLPVGIMPEGTIISSVEEKT 120 Query: 380 GDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRA 511 GDRGRLAR SGN+ATVI HN + KRTRVKLPSG KKV+PSSNRA Sbjct: 121 GDRGRLARTSGNYATVISHNVEKKRTRVKLPSGIKKVIPSSNRA 164 Score = 70.1 bits (164), Expect = 1e-12 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 531 GGRIDKPILKAGRAYHKYKVKRNCWPYVRGVA 626 GGRIDKP+LKAGRAYHKYK KRNCWP VRGVA Sbjct: 172 GGRIDKPMLKAGRAYHKYKAKRNCWPRVRGVA 203 >SB_42692| Best HMM Match : Ribosomal_L2_C (HMM E-Value=4.9e-05) Length = 123 Score = 201 bits (491), Expect = 3e-52 Identities = 91/122 (74%), Positives = 107/122 (87%), Gaps = 1/122 (0%) Frame = +2 Query: 149 GVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIVPK-LYTGQFVYCGKKATLEVGNVM 325 GVVK+IIHDPGRGAPLAVV FRDPY++K RKELF+ + +YTGQF+YCGKKA L++GN + Sbjct: 1 GVVKEIIHDPGRGAPLAVVVFRDPYRYKLRKELFVATEGMYTGQFIYCGKKAALQIGNCL 60 Query: 326 PVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSN 505 PVG MPEGTI+ ++EEK GDRGRLAR SGN+ATVI HN + KRTRVKLPSG KKV+PSSN Sbjct: 61 PVGIMPEGTIISSVEEKTGDRGRLARTSGNYATVISHNVEKKRTRVKLPSGIKKVIPSSN 120 Query: 506 RA 511 RA Sbjct: 121 RA 122 >SB_43058| Best HMM Match : Ribosomal_L2_C (HMM E-Value=8.26766e-44) Length = 222 Score = 41.1 bits (92), Expect = 7e-04 Identities = 39/125 (31%), Positives = 62/125 (49%), Gaps = 6/125 (4%) Frame = +2 Query: 143 IKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIVP-KLYTGQFVYC--GKK---AT 304 IK V + +DP R A +A+V +++L I P ++ G + GK A Sbjct: 56 IKDKVLQVGYDPCRSARIALVAGNG----SNQEKLVIAPDEIQVGDVMTASRGKPESLAL 111 Query: 305 LEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAK 484 L+ G+ P+ +P GT+V N+E G +LARA+G A +I + V+LPS + Sbjct: 112 LKPGDAYPLCFLPIGTVVHNIELYPGKGAQLARAAGTSAQLIRKTNET--AVVRLPSKVE 169 Query: 485 KVLPS 499 K + S Sbjct: 170 KEVSS 174 >SB_39055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 448 Score = 31.1 bits (67), Expect = 0.77 Identities = 16/75 (21%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = -2 Query: 454 TLSIRIVSNHSGEVSRGTCQTTSITHFLFKIAHNG--TLRHSSNRHHISNFKSCFLSTIN 281 T SI ++ + + + GTC+ + FK+ H + H + H ++N C + ++ Sbjct: 76 THSILVLLSAAACAANGTCEEPRRRNTFFKLKHKDRMLIDHVISSHDVTNPIHCSMECLS 135 Query: 280 KLACVELRDNEELLP 236 CV +++ P Sbjct: 136 NQRCVSFNLKKQITP 150 >SB_16681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = +2 Query: 341 PEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRAWS 517 P G I+ + +GD+ R +GN T A + +PS L + +RAWS Sbjct: 218 PNGRILPEIPNHVGDKHEKKR-NGNAKTNEADRIGADSSSTAIPSSCTSTLSNHSRAWS 275 >SB_20840| Best HMM Match : Rota_NS26 (HMM E-Value=4.2) Length = 466 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = +2 Query: 341 PEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRAWS 517 P G I+ + +GD+ R +GN T A + +PS L + +RAWS Sbjct: 332 PNGRILPEIPNHVGDKHEKKR-NGNAKTNEADRIGADSSSTAIPSSCTSTLSNHSRAWS 389 >SB_6614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 334 SNRHHISNFKSCFLSTINKLACVELRDNEE 245 +NRH I + + ST NK C +D E+ Sbjct: 196 TNRHRIGKYDATAASTKNKQKCTTTKDTEQ 225 >SB_59547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1516 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 227 TCMDRGSVQQPKVHLYQGHGLY 162 T D G +Q P HLY+ HG Y Sbjct: 515 TVTDIGDLQYPVFHLYKEHGWY 536 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 314 GNVMPVGAMPEGTIVCNLEEKMGDRGRLAR-ASGNFATVIG 433 G+ PV +P G +C + +G R AR G F ++ G Sbjct: 737 GHSKPVDGLPRGDAICGCPKAIGRRHARARLLEGRFLSISG 777 >SB_59208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 27.5 bits (58), Expect = 9.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 140 IHDVQRNLKSEV*ERLSSSSCEKRKLNRHPYAEHVLHD 27 I +V + + + R++SS C KRKL R E+ + D Sbjct: 470 IQEVVKRERKKQRNRIASSKCRKRKLEREARLENRVKD 507 >SB_55367| Best HMM Match : Granulin (HMM E-Value=0.00023) Length = 565 Score = 27.5 bits (58), Expect = 9.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 193 FGCCTLPRSIQVQDK 237 FGCC +P ++ QDK Sbjct: 182 FGCCVMPNAVHCQDK 196 >SB_22791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1798 Score = 27.5 bits (58), Expect = 9.4 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 3/86 (3%) Frame = +2 Query: 347 GTIVCNLEE---KMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRAWS 517 G I+C + + K D G+ R G F ++ + + +R K+ A +VL + W+ Sbjct: 1575 GPILCAIHQVVNKSLDNGKQCREHGGFKKIVAISKNKERYSYKILKTANQVLMT---LWA 1631 Query: 518 VLLLRWTY*QTYFESWKGIPQVQGQT 595 + LR + + +E K + G T Sbjct: 1632 LTALRNSLKKEEWELTKEVTDEYGPT 1657 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,060,844 Number of Sequences: 59808 Number of extensions: 458382 Number of successful extensions: 1130 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1055 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1128 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -