BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00706 (626 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 25 0.60 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.4 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 25.0 bits (52), Expect = 0.60 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 428 IGHNPDAKRTRVKLPSGAKKVLPSSNRAWSVLLLR 532 IG+ + K+TR LP+G +KVL + + VL+++ Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVLVHNVKELEVLMMQ 90 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 379 HFLFKIAHNGTLRHSSNRHHI 317 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 379 HFLFKIAHNGTLRHSSNRHHI 317 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 379 HFLFKIAHNGTLRHSSNRHHI 317 HF +I NGT+ + RH I Sbjct: 214 HFALRIYRNGTVNYLMRRHLI 234 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 379 HFLFKIAHNGTLRHSSNRHHI 317 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 586 LYLWYALPAFKIGLSIRPPQQQYRPCS 506 L L +A PA+ G P QQQ P S Sbjct: 1263 LMLQHAPPAYSCGTVSVPQQQQLPPSS 1289 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,005 Number of Sequences: 438 Number of extensions: 4180 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -