BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00705 (622 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 23 1.6 AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory recept... 23 1.6 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 2.7 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 4.8 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 423 EIMRDFSKFLLMLDSNMKLGIHCNYYF 503 EI FS LLM ++ +GI C+ YF Sbjct: 233 EIQTIFSVPLLMKIASQFVGIFCSLYF 259 >AM292346-1|CAL23158.2| 314|Tribolium castaneum gustatory receptor candidate 25 protein. Length = 314 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 423 EIMRDFSKFLLMLDSNMKLGIHCNYYF 503 EI FS LLM ++ +GI C+ YF Sbjct: 58 EIQTIFSVPLLMKIASQFVGIFCSLYF 84 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 22.6 bits (46), Expect = 2.7 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = +2 Query: 362 IDSR*VLKKPLEILVFFLVV*NNERFFKISPYVRFEYEIRDT-L*LLF*SRQPTVCRLRD 538 ++ R +L ++ F +V+ + K+SP V F DT L +L S R + Sbjct: 314 LNRRTILGVSNAVITFLIVMVQKASYEKLSPVVLFIQVAADTVLFILNISTIIITARKKQ 373 Query: 539 QW 544 QW Sbjct: 374 QW 375 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 438 FSKFLLMLDSNMKLGIH 488 + KF N+KLGIH Sbjct: 423 YKKFYEQFSKNIKLGIH 439 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,954 Number of Sequences: 336 Number of extensions: 2378 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -