BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00697 (743 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces po... 26 4.9 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 25 8.6 >SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1057 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 144 KMNEEDQHMPPAKKPKVDNSVEDVDFTQDVSIVDNNKTLR*VLINILI 287 KM P AKK +DN + + V+I+ N + LI +LI Sbjct: 693 KMTNASYTYPNAKKKSLDNVTVGLSLSSRVAILGPNGAGKSTLIKVLI 740 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 25.4 bits (53), Expect = 8.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 743 NSFCFSSSSKYFLYARHGMALMGISC 666 +S CF SSS++F YA A C Sbjct: 1924 DSTCFPSSSRWFQYAPSSTACQMFDC 1949 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,989,968 Number of Sequences: 5004 Number of extensions: 61496 Number of successful extensions: 162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -