SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00696
         (781 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_01_0535 - 4610339-4610707,4611910-4613049,4613342-4613419           28   9.6  

>05_01_0535 - 4610339-4610707,4611910-4613049,4613342-4613419
          Length = 528

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 5/49 (10%)
 Frame = -1

Query: 313 PK*R*VYMSRTSYNIIKF-----KRLYQILKGILKTWPLKISKNDYLII 182
           PK   VY+ + +Y II+F     K    +++G+LK WP+  S+ + + +
Sbjct: 322 PKTVGVYLPQLTYCIIQFIEKEPKLAGTVIRGLLKYWPVTNSQKEMMFL 370


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,649,365
Number of Sequences: 37544
Number of extensions: 302366
Number of successful extensions: 495
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 489
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 495
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2091906552
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -